Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NRP1 Monoclonal Antibody | anti-NRP1 antibody

NRP1 (VEGF165R, Neuropilin-1, Vascular Endothelial Cell Growth Factor 165 Receptor, CD304, DKFZp686A03134, DKFZp781F1414) (MaxLight 750)

Gene Names
NRP1; NP1; NRP; BDCA4; CD304; VEGF165R
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NRP1; Monoclonal Antibody; NRP1 (VEGF165R; Neuropilin-1; Vascular Endothelial Cell Growth Factor 165 Receptor; CD304; DKFZp686A03134; DKFZp781F1414) (MaxLight 750); anti-NRP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B3
Specificity
Recognizes human NRP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-NRP1 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa22-132 from NRP1 (NP_0038640) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NRP1 antibody
The membrane-bound isoform 1 is a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform of PGF, The VEGF-165 isoform of VEGF and VEGF-B. Coexpression with KDR results in increased VEGF-165 binding to KDR as well as increased chemotaxis. It may regulate VEGF-induced angiogenesis.
Product Categories/Family for anti-NRP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94.8kDa (843aa) 100-150kDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
neuropilin-1 isoform a
NCBI Official Synonym Full Names
neuropilin 1
NCBI Official Symbol
NRP1
NCBI Official Synonym Symbols
NP1; NRP; BDCA4; CD304; VEGF165R
NCBI Protein Information
neuropilin-1
UniProt Protein Name
Neuropilin-1
Protein Family
UniProt Gene Name
NRP1
UniProt Synonym Gene Names
NRP; VEGF165R
UniProt Entry Name
NRP1_HUMAN

NCBI Description

This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. Several alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

NRP1: The membrane-bound isoform 1 is a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform of PGF, The VEGF-165 isoform of VEGF and VEGF-B. Coexpression with KDR results in increased VEGF-165 binding to KDR as well as increased chemotaxis. It may regulate VEGF-induced angiogenesis. Homodimer, and heterodimer with NRP2. Interacts with FER. Binds PLXNB1. The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly expressed in heart and placenta; moderately in lung, liver, skeletal muscle, kidney and pancreas; and low in adult brain. Isoform 2 is found in liver hepatocytes, kidney distal and proximal tubules. Belongs to the neuropilin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p12

Cellular Component: extracellular space; cell surface; focal adhesion; growth cone; cell soma; axon; early endosome; neurofilament; integral to membrane; plasma membrane; cytoplasmic vesicle; cytosol; receptor complex

Molecular Function: heparin binding; vascular endothelial growth factor receptor activity; protein binding; semaphorin receptor activity; metal ion binding; growth factor binding; cytokine binding; coreceptor activity

Biological Process: axon guidance; facial nerve structural organization; neuron migration; vestibulocochlear nerve structural organization; platelet-derived growth factor receptor signaling pathway; positive regulation of smooth muscle cell migration; negative regulation of axon extension involved in axon guidance; signal transduction; gonadotrophin-releasing hormone neuronal migration to the hypothalamus; cell-cell signaling; positive chemotaxis; branchiomotor neuron axon guidance; dendrite development; response to wounding; negative regulation of neuron apoptosis; angiogenesis; trigeminal nerve structural organization; axonal fasciculation; hepatocyte growth factor receptor signaling pathway; patterning of blood vessels; axon extension involved in axon guidance; positive regulation of peptidyl-tyrosine phosphorylation; organ morphogenesis; cell migration during sprouting angiogenesis; otic placode formation; positive regulation of axon extension involved in axon guidance; artery morphogenesis; positive regulation of endothelial cell proliferation; nerve development; sprouting angiogenesis; vascular endothelial growth factor receptor signaling pathway; retinal ganglion cell axon guidance

Research Articles on NRP1

Similar Products

Product Notes

The NRP1 nrp1 (Catalog #AAA6234222) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NRP1 (VEGF165R, Neuropilin-1, Vascular Endothelial Cell Growth Factor 165 Receptor, CD304, DKFZp686A03134, DKFZp781F1414) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NRP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NRP1 nrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NRP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.