Mouse anti-Human NRP1 Monoclonal Antibody | anti-NRP1 antibody

NRP1 (VEGF165R, Neuropilin-1, Vascular Endothelial Cell Growth Factor 165 Receptor, CD304, DKFZp686A03134, DKFZp781F1414) APC

Cat. Num. AAA6137961

• Gene Names: NRP1; NP1; NRP; BDCA4; CD304; VEGF165R
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NRP1; Monoclonal Antibody; NRP1 (VEGF165R; Neuropilin-1; Vascular Endothelial Cell Growth Factor 165 Receptor; CD304; DKFZp686A03134; DKFZp781F1414) APC; anti-NRP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B3
• Specificity: Recognizes human NRP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-NRP1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa22-132 from NRP1 (NP_0038640) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(NRP1 monoclonal antibody Western Blot analysis of NRP1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of NRP1 expression in transfected 293T cell line by NRP1 monoclonal antibody Lane 1: NRP1 transfected lysate (68.3kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NRP1 transfected lysate using NRP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with NRP1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged NRP1 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-NRP1 antibody

The membrane-bound isoform 1 is a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform of PGF, The VEGF-165 isoform of VEGF and VEGF-B. Coexpression with KDR results in increased VEGF-165 binding to KDR as well as increased chemotaxis. It may regulate VEGF-induced angiogenesis.

Product Categories/Family for anti-NRP1 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 182508169
• NCBI GeneID: 8829
• NCBI Accession #: NP_003864
• NCBI GenBank Nucleotide #: NM_003873
• UniProt Accession #: O14786; O60461; Q5T7F1; Q5T7F2; Q5T7F3; Q86T59; Q96I90; Q96IH5; B0LPG9
• Molecular Weight: 94.8kDa (843aa) 100-150kDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: neuropilin-1 isoform a
• NCBI Official Synonym Full Names: neuropilin 1
• NCBI Official Symbol: NRP1
• NCBI Official Synonym Symbols: NP1; NRP; BDCA4; CD304; VEGF165R
• NCBI Protein Information: neuropilin-1
• UniProt Protein Name: Neuropilin-1
• Protein Family: Neuropilin
• UniProt Gene Name: NRP1
• UniProt Synonym Gene Names: NRP; VEGF165R
• UniProt Entry Name: NRP1_HUMAN

NCBI Description

This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. Several alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

NRP1: The membrane-bound isoform 1 is a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform of PGF, The VEGF-165 isoform of VEGF and VEGF-B. Coexpression with KDR results in increased VEGF-165 binding to KDR as well as increased chemotaxis. It may regulate VEGF-induced angiogenesis. Homodimer, and heterodimer with NRP2. Interacts with FER. Binds PLXNB1. The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly expressed in heart and placenta; moderately in lung, liver, skeletal muscle, kidney and pancreas; and low in adult brain. Isoform 2 is found in liver hepatocytes, kidney distal and proximal tubules. Belongs to the neuropilin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p12

Cellular Component: extracellular space; cell surface; focal adhesion; growth cone; cell soma; axon; early endosome; neurofilament; integral to membrane; plasma membrane; cytoplasmic vesicle; cytosol; receptor complex

Molecular Function: heparin binding; vascular endothelial growth factor receptor activity; protein binding; semaphorin receptor activity; metal ion binding; growth factor binding; cytokine binding; coreceptor activity

Biological Process: axon guidance; facial nerve structural organization; neuron migration; vestibulocochlear nerve structural organization; platelet-derived growth factor receptor signaling pathway; positive regulation of smooth muscle cell migration; negative regulation of axon extension involved in axon guidance; signal transduction; gonadotrophin-releasing hormone neuronal migration to the hypothalamus; cell-cell signaling; positive chemotaxis; branchiomotor neuron axon guidance; dendrite development; response to wounding; negative regulation of neuron apoptosis; angiogenesis; trigeminal nerve structural organization; axonal fasciculation; hepatocyte growth factor receptor signaling pathway; patterning of blood vessels; axon extension involved in axon guidance; positive regulation of peptidyl-tyrosine phosphorylation; organ morphogenesis; cell migration during sprouting angiogenesis; otic placode formation; positive regulation of axon extension involved in axon guidance; artery morphogenesis; positive regulation of endothelial cell proliferation; nerve development; sprouting angiogenesis; vascular endothelial growth factor receptor signaling pathway; retinal ganglion cell axon guidance