Mouse anti-Human NRG2 Monoclonal Antibody | anti-NRG2 antibody

NRG2 (Pro-neuregulin-2, Membrane-bound Isoform, Pro-NRG2, NTAK, DKFZp434P086, MGC138699, pp9320, PP9320, TRG-16) (HRP)

Cat. Num. AAA6153869

• Gene Names: NRG2; DON1; HRG2; NTAK
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NRG2; Monoclonal Antibody; NRG2 (Pro-neuregulin-2; Membrane-bound Isoform; Pro-NRG2; NTAK; DKFZp434P086; MGC138699; pp9320; PP9320; TRG-16) (HRP); anti-NRG2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D2
• Specificity: Recognizes human NRG2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 850

• Applicable Applications for anti-NRG2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa116-215 from NRG2 (NP_004874) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(NRG2 monoclonal antibody Western Blot analysis of NRG2 expression in human pancreas.)

Testing Data

(Detection limit for recombinant GST tagged NRG2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-NRG2 antibody

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

Product Categories/Family for anti-NRG2 antibody

Antibodies; Growth Factors; Cytokines

References

1. Activation of ErbB3, EGFR and Erk is essential for growth of human breast cancer cell lines with acquired resistance to fulvestrant. Frogne T, Benjaminsen RV, Sonne-Hansen K, Sorensen BS, Nexo E, Laenkholm AV, Rasmussen LM, Riese DJ 2nd, de Cremoux P, Stenvang J, Lykkesfeldt AE.Breast Cancer Res Treat. 2009 Mar;114(2):263-75. Epub 2008 Apr 14.

NCBI and Uniprot Product Information

• NCBI GI #: 4758832
• NCBI GeneID: 9542
• NCBI Accession #: NP_004874
• NCBI GenBank Nucleotide #: NP_004874.1
• UniProt Accession #: O14511
• NCBI Official Full Name: pro-neuregulin-2, membrane-bound isoform isoform 1
• NCBI Official Synonym Full Names: neuregulin 2
• NCBI Official Symbol: NRG2
• NCBI Official Synonym Symbols: DON1; HRG2; NTAK
• NCBI Protein Information: pro-neuregulin-2, membrane-bound isoform
• UniProt Protein Name: Pro-neuregulin-2, membrane-bound isoform
• Protein Family: Pro-neuregulin
• UniProt Gene Name: NRG2
• UniProt Synonym Gene Names: NTAK; Pro-NRG2; NRG-2; DON-1; NTAK
• UniProt Entry Name: NRG2_HUMAN

NCBI Description

This gene encodes a novel member of the neuregulin family of growth and differentiation factors. Through interaction with the ERBB family of receptors, this protein induces the growth and differentiation of epithelial, neuronal, glial, and other types of cells. The gene consists of 12 exons and the genomic structure is similar to that of neuregulin 1, another member of the neuregulin family of ligands. The products of these genes mediate distinct biological processes by acting at different sites in tissues and eliciting different biological responses in cells. This gene is located close to the region for demyelinating Charcot-Marie-Tooth disease locus, but is not responsible for this disease. Alternative transcript variants encoding distinct isoforms have been described. [provided by RefSeq, May 2010]

Uniprot Description

NRG2: Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. Belongs to the neuregulin family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: extracellular space; plasma membrane; integral to membrane; extracellular region

Molecular Function: growth factor activity; receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; embryonic development; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; organ development; innate immune response; signal transduction