Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human NRG2 Monoclonal Antibody | anti-NRG2 antibody

NRG2 (Pro-neuregulin-2, Membrane-bound Isoform, Pro-NRG2, NTAK, DKFZp434P086, MGC138699, pp9320, PP9320, TRG-16) APC

Gene Names
NRG2; DON1; HRG2; NTAK
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NRG2; Monoclonal Antibody; NRG2 (Pro-neuregulin-2; Membrane-bound Isoform; Pro-NRG2; NTAK; DKFZp434P086; MGC138699; pp9320; PP9320; TRG-16) APC; anti-NRG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D2
Specificity
Recognizes human NRG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
850
Applicable Applications for anti-NRG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa116-215 from NRG2 (NP_004874) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(NRG2 monoclonal antibody Western Blot analysis of NRG2 expression in human pancreas.)

Western Blot (WB) (NRG2 monoclonal antibody Western Blot analysis of NRG2 expression in human pancreas.)

Testing Data

(Detection limit for recombinant GST tagged NRG2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NRG2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-NRG2 antibody
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Product Categories/Family for anti-NRG2 antibody
References
1. Activation of ErbB3, EGFR and Erk is essential for growth of human breast cancer cell lines with acquired resistance to fulvestrant. Frogne T, Benjaminsen RV, Sonne-Hansen K, Sorensen BS, Nexo E, Laenkholm AV, Rasmussen LM, Riese DJ 2nd, de Cremoux P, Stenvang J, Lykkesfeldt AE.Breast Cancer Res Treat. 2009 Mar;114(2):263-75. Epub 2008 Apr 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
pro-neuregulin-2, membrane-bound isoform isoform 1
NCBI Official Synonym Full Names
neuregulin 2
NCBI Official Symbol
NRG2
NCBI Official Synonym Symbols
DON1; HRG2; NTAK
NCBI Protein Information
pro-neuregulin-2, membrane-bound isoform
UniProt Protein Name
Pro-neuregulin-2, membrane-bound isoform
Protein Family
UniProt Gene Name
NRG2
UniProt Synonym Gene Names
NTAK; Pro-NRG2; NRG-2; DON-1; NTAK
UniProt Entry Name
NRG2_HUMAN

NCBI Description

This gene encodes a novel member of the neuregulin family of growth and differentiation factors. Through interaction with the ERBB family of receptors, this protein induces the growth and differentiation of epithelial, neuronal, glial, and other types of cells. The gene consists of 12 exons and the genomic structure is similar to that of neuregulin 1, another member of the neuregulin family of ligands. The products of these genes mediate distinct biological processes by acting at different sites in tissues and eliciting different biological responses in cells. This gene is located close to the region for demyelinating Charcot-Marie-Tooth disease locus, but is not responsible for this disease. Alternative transcript variants encoding distinct isoforms have been described. [provided by RefSeq, May 2010]

Uniprot Description

NRG2: Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. Belongs to the neuregulin family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: extracellular space; plasma membrane; integral to membrane; extracellular region

Molecular Function: growth factor activity; receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; embryonic development; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; organ development; innate immune response; signal transduction

Research Articles on NRG2

Similar Products

Product Notes

The NRG2 nrg2 (Catalog #AAA6137960) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NRG2 (Pro-neuregulin-2, Membrane-bound Isoform, Pro-NRG2, NTAK, DKFZp434P086, MGC138699, pp9320, PP9320, TRG-16) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NRG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NRG2 nrg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NRG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.