Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NR2F2 Monoclonal Antibody | anti-NR2F2 antibody

NR2F2 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 Group F Member 2, ARP1, TFCOUP2) (MaxLight 490)

Gene Names
NR2F2; ARP1; CHTD4; NF-E3; NR2F1; SVP40; COUPTFB; TFCOUP2; COUPTFII
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR2F2; Monoclonal Antibody; NR2F2 (COUP Transcription Factor 2; COUP-TF2; Apolipoprotein A-I Regulatory Protein 1; ARP-1; COUP Transcription Factor II; COUP-TF II; Nuclear Receptor Subfamily 2 Group F Member 2; ARP1; TFCOUP2) (MaxLight 490); anti-NR2F2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D8
Specificity
Recognizes human NR2F2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-NR2F2 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa153-241 from human NR2F2 (NP_066285) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NR2F2 antibody
COUP-TFII, a NR2 Hepatocyte NF4-Like receptor, has been shown to affect neuronal development and differentiation, homeostasis in various Human tissues, mesenchymal-epithelial interactions during organogenesis, and the development of the cardiovascular system. COUP-TFII interacts with and modulates several nuclear receptors, including estrogen receptor alpha (ER alpha), thyroid hormone receptors (TR), PPAR alpha, and retinoic acid receptors (RAR). Mice lacking COUP-TFII show abnormal heart and vascular development. COUP-TFII expression has been documented in Human adrenal, lung, kidney, liver, spleen, skeletal muscle, and breast. ESTs have been isolated from Human tissue libraries, including cancerous adrenal, bladder, brain, breast, colon, head/neck, kidney, lung, ovary, pancreas, pituitary, prostate, skeletal muscle, skin, smooth muscle, stomach, synovium, and uterus, and normal brain, adipose, adrenal, blood, brain, breast, cervix, ear, embryo, gallbladder, ganglion, heart, kidney, liver/spleen, lung, ovary, placenta, prostate, skin, spleen, testis, uterus, and vessel.
Product Categories/Family for anti-NR2F2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,163 Da
NCBI Official Full Name
COUP transcription factor 2 isoform a
NCBI Official Synonym Full Names
nuclear receptor subfamily 2, group F, member 2
NCBI Official Symbol
NR2F2
NCBI Official Synonym Symbols
ARP1; CHTD4; NF-E3; NR2F1; SVP40; COUPTFB; TFCOUP2; COUPTFII
NCBI Protein Information
COUP transcription factor 2
UniProt Protein Name
COUP transcription factor 2
Protein Family
UniProt Gene Name
NR2F2
UniProt Synonym Gene Names
ARP1; TFCOUP2; COUP-TF2; ARP-1; COUP-TF II
UniProt Entry Name
COT2_HUMAN

NCBI Description

This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

NR2F2: Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. Interacts with SQSTM1. Binds DNA as a dimer; homodimer or heterodimer with NR2F6. Interacts with NCOA1, NCOA2, NCOA3 and PPARGC1A. Interacts with ZFPM2. Ubiquitous. Belongs to the nuclear hormone receptor family. NR2 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q26

Cellular Component: nucleus

Molecular Function: ligand-dependent nuclear receptor activity; protein binding; protein homodimerization activity; retinoic acid binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription corepressor activity; transcription factor activity

Biological Process: limb development; skeletal muscle development; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; neuron migration; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; signal transduction; response to estradiol stimulus; anterior/posterior pattern formation; regulation of transcription from RNA polymerase II promoter; fertilization; forebrain development; negative regulation of endothelial cell proliferation; blood vessel morphogenesis; steroid hormone mediated signaling; lipid metabolic process; negative regulation of transcription, DNA-dependent; radial pattern formation; maternal placenta development

Disease: Congenital Heart Defects, Multiple Types, 4

Research Articles on NR2F2

Similar Products

Product Notes

The NR2F2 nr2f2 (Catalog #AAA6202188) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NR2F2 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 Group F Member 2, ARP1, TFCOUP2) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR2F2 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR2F2 nr2f2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR2F2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.