Western Blot (WB)
(Western Blot detection against Immunogen (38.39kD).)
Mouse anti-Human NPY1R Monoclonal Antibody | anti-NPY1R antibody
NPY1R (NPYR, NPYY1, Neuropeptide Y Receptor Type 1) (AP)
Gene Names
NPY1R; NPYR; NPY1-R
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NPY1R; Monoclonal Antibody; NPY1R (NPYR; NPYY1; Neuropeptide Y Receptor Type 1) (AP); anti-NPY1R antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G2
Specificity
Recognizes human NPY1R.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NPY1R antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-116 from human NPY1R (AAH36657) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.39kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.39kD).)
Testing Data
(Detection limit for recombinant GST tagged NPY1R is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NPY1R is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NPY1R antibody
Neuropeptide Y (NPY; MIM 162640) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle (Herzog et al., 1992 [PubMed 1321422]).
Product Categories/Family for anti-NPY1R antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
44,392 Da
NCBI Official Full Name
Homo sapiens neuropeptide Y receptor Y1, mRNA
NCBI Official Synonym Full Names
neuropeptide Y receptor Y1
NCBI Official Symbol
NPY1R
NCBI Official Synonym Symbols
NPYR; NPY1-R
NCBI Protein Information
neuropeptide Y receptor type 1
Protein Family
NCBI Description
This gene belongs to the G-protein-coupled receptor superfamily. The encoded transmembrane protein mediates the function of neuropeptide Y (NPY), a neurotransmitter, and peptide YY (PYY), a gastrointestinal hormone. The encoded receptor undergoes fast agonist-induced internalization through clathrin-coated pits and is subsequently recycled back to the cell membrane. Activation of Y1 receptors may result in mobilization of intracellular calcium and inhibition of adenylate cyclase activity. [provided by RefSeq, Aug 2013]
Research Articles on NPY1R
Similar Products
Product Notes
The NPY1R (Catalog #AAA6132636) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NPY1R (NPYR, NPYY1, Neuropeptide Y Receptor Type 1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NPY1R can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NPY1R for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NPY1R, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
