Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NPTX1 expression in transfected 293T cell line by NPTX1 monoclonal antibody (M06), clone 7E6.Lane 1: NPTX1 transfected lysate (Predicted MW: 47.52 KDa).Lane 2: Non-transfected lysate.)

Mouse NPTX1 Monoclonal Antibody | anti-NPTX1 antibody

NPTX1 (Neuronal Pentraxin I, DKFZp686J2446, MGC105123, NP1) (Biotin)

Gene Names
NPTX1; NP1
Applications
Western Blot
Purity
Purified
Synonyms
NPTX1; Monoclonal Antibody; NPTX1 (Neuronal Pentraxin I; DKFZp686J2446; MGC105123; NP1) (Biotin); Neuronal Pentraxin I; NP1; anti-NPTX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
7000000
Specificity
Recognizes NPTX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NPTX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NPTX1 (NP_002513.2, 141aa-240aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NPTX1 expression in transfected 293T cell line by NPTX1 monoclonal antibody (M06), clone 7E6.Lane 1: NPTX1 transfected lysate (Predicted MW: 47.52 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NPTX1 expression in transfected 293T cell line by NPTX1 monoclonal antibody (M06), clone 7E6.Lane 1: NPTX1 transfected lysate (Predicted MW: 47.52 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NPTX1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NPTX1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-NPTX1 antibody
NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq]
Product Categories/Family for anti-NPTX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,122 Da
NCBI Official Full Name
neuronal pentraxin-1
NCBI Official Synonym Full Names
neuronal pentraxin 1
NCBI Official Symbol
NPTX1
NCBI Official Synonym Symbols
NP1
NCBI Protein Information
neuronal pentraxin-1
UniProt Protein Name
Neuronal pentraxin-1
Protein Family
UniProt Gene Name
NPTX1
UniProt Synonym Gene Names
NP1; NP-I

NCBI Description

NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq, Jul 2008]

Uniprot Description

May be involved in mediating uptake of synaptic material during synapse remodeling or in mediating the synaptic clustering of AMPA glutamate receptors at a subset of excitatory synapses.

Research Articles on NPTX1

Similar Products

Product Notes

The NPTX1 nptx1 (Catalog #AAA6174155) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NPTX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NPTX1 nptx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NPTX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.