Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (40.48kD).)

Mouse anti-Human NPPB Monoclonal Antibody | anti-NPPB antibody

NPPB (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide) (AP)

Gene Names
NPPB; BNP
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NPPB; Monoclonal Antibody; NPPB (Natriuretic Peptides B; Gamma-brain Natriuretic Peptide) (AP); anti-NPPB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
2D11
Specificity
Recognizes human NPPB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NPPB antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-135 from human NPPB (AAH25785) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.48kD).)

Western Blot (WB) (Western Blot detection against Immunogen (40.48kD).)

Western Blot (WB)

(Western Blot analysis of NPPB expression in transfected 293T cell line by NPPB monoclonal antibody. Lane 1: NPPB transfected lysate (14.726kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NPPB expression in transfected 293T cell line by NPPB monoclonal antibody. Lane 1: NPPB transfected lysate (14.726kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NPPB transfected lysate using NPPB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NPPB rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NPPB transfected lysate using NPPB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NPPB rabbit polyclonal antibody.)
Related Product Information for anti-NPPB antibody
In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134aa precursor (prepro-BNP), which is cleaved by proteases to form a 26aa "signal" peptide and a 108aa pro-BNP. Proteolytic digestion of pro-BNP results in formation of 76aa amino-terminal NT-proBNP and biologically active 32aa BNP hormone molecule. Both proBNP and NTproBNP circulate in human plasma and have been proposed as markers for early identification of left ventricular dysfunction as well as prognostic markers of possible cardiac complications at patients with heart failure.
Product Categories/Family for anti-NPPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
14,726 Da
NCBI Official Full Name
Homo sapiens natriuretic peptide B, mRNA
NCBI Official Synonym Full Names
natriuretic peptide B
NCBI Official Symbol
NPPB
NCBI Official Synonym Symbols
BNP
NCBI Protein Information
natriuretic peptides B
Protein Family

NCBI Description

This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq, Nov 2014]

Research Articles on NPPB

Similar Products

Product Notes

The NPPB (Catalog #AAA6132632) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NPPB (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NPPB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NPPB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NPPB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.