Mouse anti-Human NPPB Monoclonal Antibody | anti-NPPB antibody

NPPB (Natriuretic Peptides B, Gamma-brain Natriuretic Peptide) (FITC)

Cat. Num. AAA6148541

• Gene Names: NPPB; BNP
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NPPB; Monoclonal Antibody; NPPB (Natriuretic Peptides B; Gamma-brain Natriuretic Peptide) (FITC); anti-NPPB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 2D11
• Specificity: Recognizes human NPPB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NPPB antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-135 from human NPPB (AAH25785) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.48kD).)

Western Blot (WB)

(Western Blot analysis of NPPB expression in transfected 293T cell line by NPPB monoclonal antibody. Lane 1: NPPB transfected lysate (14.726kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NPPB transfected lysate using NPPB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NPPB rabbit polyclonal antibody.)

Related Product Information for anti-NPPB antibody

In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134aa precursor (prepro-BNP), which is cleaved by proteases to form a 26aa "signal" peptide and a 108aa pro-BNP. Proteolytic digestion of pro-BNP results in formation of 76aa amino-terminal NT-proBNP and biologically active 32aa BNP hormone molecule. Both proBNP and NTproBNP circulate in human plasma and have been proposed as markers for early identification of left ventricular dysfunction as well as prognostic markers of possible cardiac complications at patients with heart failure.

Product Categories/Family for anti-NPPB antibody

Antibodies; Hormones; Steroids

NCBI and Uniprot Product Information

• NCBI GI #: 19343959
• NCBI GeneID: 4879
• Molecular Weight: 14,726 Da
• NCBI Official Full Name: Homo sapiens natriuretic peptide B, mRNA
• NCBI Official Synonym Full Names: natriuretic peptide B
• NCBI Official Symbol: NPPB
• NCBI Official Synonym Symbols: BNP
• NCBI Protein Information: natriuretic peptides B
• Protein Family: Natriuretic peptides

NCBI Description

This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq, Nov 2014]