Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse NOL3 Monoclonal Antibody | anti-NOL3 antibody

NOL3 (Nucleolar Protein 3 (Apoptosis Repressor with CARD Domain), ARC, CARD2, MYC, MYP, NOP, NOP30) (MaxLight 650)

Gene Names
NOL3; ARC; FCM; MYP; NOP; NOP30
Applications
Western Blot
Purity
Purified
Synonyms
NOL3; Monoclonal Antibody; NOL3 (Nucleolar Protein 3 (Apoptosis Repressor with CARD Domain); ARC; CARD2; MYC; MYP; NOP; NOP30) (MaxLight 650); Nucleolar Protein 3 (Apoptosis Repressor with CARD Domain); NOP30; anti-NOL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A9
Specificity
Recognizes NOL3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-NOL3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NOL3 (NP_003937.1, 1aa-208aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NOL3 antibody
Mouse monoclonal antibody raised against a full-length recombinant NOL3.
Product Categories/Family for anti-NOL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,355 Da
NCBI Official Full Name
nucleolar protein 3 isoform MYP
NCBI Official Synonym Full Names
nucleolar protein 3 (apoptosis repressor with CARD domain)
NCBI Official Symbol
NOL3
NCBI Official Synonym Symbols
ARC; FCM; MYP; NOP; NOP30
NCBI Protein Information
nucleolar protein 3; nucleolar protein of 30 kDa; muscle-enriched cytoplasmic protein
UniProt Protein Name
Nucleolar protein 3
Protein Family
UniProt Gene Name
NOL3
UniProt Synonym Gene Names
ARC; NOP; Myp; Nop30
UniProt Entry Name
NOL3_HUMAN

Uniprot Description

Function: Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.

Subunit structure: Interacts with TFPT

By similarity. Isoform 1 oligomerizes and binds to SFRS9/SRp30C and also interacts with NPM1. Isoform 2 binds CASP2/caspase-2 and CASP8/caspase-8 and inhibits caspase-8 activity. Ref.1

Subcellular location: Isoform 1: Nucleus › nucleolus. Isoform 2: Cytoplasm.

Tissue specificity: Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.

Sequence similarities: Contains 1 CARD domain.

Similar Products

Product Notes

The NOL3 nol3 (Catalog #AAA6228978) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NOL3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOL3 nol3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.