Mouse anti-Human Nociceptin Receptor Monoclonal Antibody | anti-OPRL1 antibody

Nociceptin Receptor (Kappa-type 3 Opioid Receptor, KOR-3, Orphanin FQ Receptor, OPRL1, OOR, ORL1)

Cat. Num. AAA6000554

• Gene Names: OPRL1; OOR; ORL1; KOR-3; NOCIR
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: Nociceptin Receptor; Monoclonal Antibody; Nociceptin Receptor (Kappa-type 3 Opioid Receptor; KOR-3; Orphanin FQ Receptor; OPRL1; OOR; ORL1); Anti -Nociceptin Receptor (Kappa-type 3 Opioid Receptor; anti-OPRL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A11
• Specificity: Recognizes human OPRL1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: DILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDYWG

• Applicable Applications for anti-OPRL1 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa110-213 from human OPRL1 (AAH38433) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged OPRL1 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-OPRL1 antibody

The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Two transcript variants encoding the same protein have been found for this gene.

Product Categories/Family for anti-OPRL1 antibody

Antibodies; Abs to Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 317108157
• NCBI GeneID: 4987
• NCBI Accession #: NP_001186948.1
• NCBI GenBank Nucleotide #: NM_001200019.1
• UniProt Accession #: P41146; Q8TD34; Q8WYH9; Q9H4K4
• Molecular Weight: 40,693 Da
• NCBI Official Full Name: nociceptin receptor
• NCBI Official Synonym Full Names: opiate receptor-like 1
• NCBI Official Symbol: OPRL1
• NCBI Official Synonym Symbols: OOR; ORL1; KOR-3; NOCIR
• NCBI Protein Information: nociceptin receptor; orphanin FQ receptor; kappa-type 3 opioid receptor; kappa3-related opioid receptor
• UniProt Protein Name: Nociceptin receptor
• Protein Family: Nociceptin receptor
• UniProt Gene Name: OPRL1
• UniProt Synonym Gene Names: OOR; ORL1; KOR-3
• UniProt Entry Name: OPRX_HUMAN

NCBI Description

The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17 aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

KOR-3: Receptor for the neuropeptide nociceptin/orphanin FQ. Has a potential role in modulating a number of brain functions, including instinctive behaviors and emotions. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: neuron projection; integral to plasma membrane; cytoplasmic membrane-bound vesicle; plasma membrane

Molecular Function: G-protein coupled receptor activity; neuropeptide binding; protein binding; nociceptin/orphanin-FQ receptor activity

Biological Process: synaptic transmission; elevation of cytosolic calcium ion concentration; neuropeptide signaling pathway; sensory perception; behavior; G-protein signaling, adenylate cyclase inhibiting pathway; sensory perception of pain