Mouse NME4 Monoclonal Antibody | anti-NME4 antibody

NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (HRP)

Cat. Num. AAA6183582

• Gene Names: NME4; NDPK-D; NM23H4; nm23-H4
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: NME4; Monoclonal Antibody; NME4 (Non-Metastatic Cells 4; Protein Expressed in; NDPK-D; NM23H4; nm23-H4) (HRP); Non-Metastatic Cells 4; nm23-H4; anti-NME4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B6
• Specificity: Recognizes NME4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NME4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NME4 (NP_005000.1, 99aa-187aa) partial recombinant protein with GST tag.
• Immunogen Sequence: RYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NME4 is 0.1 ng/ml as a capture antibody.)

Product Categories/Family for anti-NME4 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4826862
• NCBI GeneID: 4833
• NCBI Accession #: NP_005000.1
• NCBI GenBank Nucleotide #: NM_005009.2
• UniProt Accession #: O00746; Q5U0M9
• Molecular Weight: 20,659 Da
• NCBI Official Full Name: nucleoside diphosphate kinase, mitochondrial
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 4
• NCBI Official Symbol: NME4
• NCBI Official Synonym Symbols: NDPK-D; NM23H4; nm23-H4
• NCBI Protein Information: nucleoside diphosphate kinase, mitochondrial; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; non-metastatic cells 4, protein expressed in
• UniProt Protein Name: Nucleoside diphosphate kinase, mitochondrial
• UniProt Gene Name: NME4
• UniProt Synonym Gene Names: NM23D; NDK; NDP kinase, mitochondrial; NDPKD
• UniProt Entry Name: NDKM_HUMAN

NCBI Description

The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]

Uniprot Description

NME4: Major role in the synthesis of nucleoside triphosphates other than ATP. Belongs to the NDK family.

Protein type: Kinase, other; Nucleotide Metabolism - purine; EC 2.7.4.6; Kinase, nucleoside diphosphate; Nucleotide Metabolism - pyrimidine; Mitochondrial; Other group; NDK family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol

Molecular Function: protein binding; metal ion binding; nucleoside diphosphate kinase activity; protein complex binding; ATP binding

Biological Process: regulation of apoptosis; GTP biosynthetic process; CTP biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside metabolic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process