Mouse anti-Human NLGN3 Monoclonal Antibody | anti-NLGN3 antibody
NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (MaxLight 650)
Gene Names
NLGN3; HNL3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NLGN3; Monoclonal Antibody; NLGN3 (Neuroligin-3; Gliotactin Homolog; KIAA1480; NL3; ASPGX1; AUTSX1) (MaxLight 650); anti-NLGN3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A6
Specificity
Recognizes human NLGN3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
828
Applicable Applications for anti-NLGN3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa590-690 from human NLGN3 (NP_061850) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NLGN3 antibody
Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and may mediate its effects by clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. May also play a role in glia-glia or glia-neuron interactions in the developing peripheral nervous system.
Product Categories/Family for anti-NLGN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
neuroligin-3 isoform 2
NCBI Official Synonym Full Names
neuroligin 3
NCBI Official Symbol
NLGN3
NCBI Official Synonym Symbols
HNL3
NCBI Protein Information
neuroligin-3
UniProt Protein Name
Neuroligin-3
Protein Family
UniProt Gene Name
NLGN3
UniProt Synonym Gene Names
KIAA1480; NL3
UniProt Entry Name
NLGN3_HUMAN
NCBI Description
This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. Mutations in this gene may be associated with autism and Asperger syndrome. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Oct 2009]
Research Articles on NLGN3
Similar Products
Product Notes
The NLGN3 nlgn3 (Catalog #AAA6223482) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NLGN3 (Neuroligin-3, Gliotactin Homolog, KIAA1480, NL3, KIAA1480, ASPGX1, AUTSX1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NLGN3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NLGN3 nlgn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NLGN3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
