Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Human lung cell line)

Rabbit Klf4 Polyclonal Antibody | anti-KLF4 antibody

Klf4 antibody - N-terminal region

Gene Names
Klf4; EZF; Zie; Gklf
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Klf4; Polyclonal Antibody; Klf4 antibody - N-terminal region; anti-KLF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH
Sequence Length
474
Applicable Applications for anti-KLF4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Human lung cell line)

Western Blot (WB) (Human lung cell line)

Western Blot (WB)

(WB Suggested Anti-Klf4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Kidney)

Western Blot (WB) (WB Suggested Anti-Klf4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Kidney)
Related Product Information for anti-KLF4 antibody
This is a rabbit polyclonal antibody against Klf4. It was validated on Western Blot

Target Description: The function of Klf4 remains unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
Krueppel-like factor 4
NCBI Official Synonym Full Names
Kruppel-like factor 4 (gut)
NCBI Official Symbol
Klf4
NCBI Official Synonym Symbols
EZF; Zie; Gklf
NCBI Protein Information
Krueppel-like factor 4
UniProt Protein Name
Krueppel-like factor 4
Protein Family
UniProt Gene Name
Klf4
UniProt Synonym Gene Names
Ezf; Gklf; Zie

Uniprot Description

Transcription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription ().

Research Articles on KLF4

Similar Products

Product Notes

The KLF4 klf4 (Catalog #AAA3204078) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Klf4 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Klf4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLF4 klf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRQPPGESDM AVSDALLPSF STFASGPAGR EKTLRPAGAP TNRWREELSH. It is sometimes possible for the material contained within the vial of "Klf4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.