Mouse NHS Monoclonal Antibody | anti-NHS antibody

NHS (Nance-Horan Syndrome (Congenital cataracts and dental anomalies), DKFZp781F2016, DKFZp781L0254, SCML1) (HRP)

Cat. Num. AAA6183170

• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: NHS; Monoclonal Antibody; NHS (Nance-Horan Syndrome (Congenital cataracts and dental anomalies); DKFZp781F2016; DKFZp781L0254; SCML1) (HRP); Nance-Horan Syndrome (Congenital cataracts and dental anomalies); SCML1; anti-NHS antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6D9
• Specificity: Recognizes NHS.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1630

• Applicable Applications for anti-NHS antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NHS (NP_938011.1, 1532aa-1629aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NHS is 0.03 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NHS on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NHS on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-NHS antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 38093637
• NCBI Accession #: NP_938011.1
• NCBI GenBank Nucleotide #: NP_938011.1
• UniProt Accession #: Q6T4R5
• NCBI Official Full Name: Nance-Horan syndrome protein isoform 1
• UniProt Protein Name: Nance-Horan syndrome protein
• Protein Family: NHS-like protein
• UniProt Gene Name: NHS
• UniProt Entry Name: NHS_HUMAN