Western Blot (WB)
(WB Suggested Anti-MBIP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)
Rabbit MBIP Polyclonal Antibody | anti-MBIP antibody
MBIP Antibody - C-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MBIP; Polyclonal Antibody; MBIP Antibody - C-terminal region; anti-MBIP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH
Sequence Length
344
Applicable Applications for anti-MBIP antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MBIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MBIP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)
Western Blot (WB)
(WB Suggested Anti-MBIP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Bladder)
Related Product Information for anti-MBIP antibody
This is a rabbit polyclonal antibody against MBIP. It was validated on Western Blot
Target Description: MBIP inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Target Description: MBIP inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Product Categories/Family for anti-MBIP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
MAP3K12-binding inhibitory protein 1 isoform 1
NCBI Official Synonym Full Names
MAP3K12 binding inhibitory protein 1
NCBI Official Symbol
MBIP
NCBI Protein Information
MAP3K12-binding inhibitory protein 1
UniProt Protein Name
MAP3K12-binding inhibitory protein 1
Protein Family
UniProt Gene Name
MBIP
UniProt Synonym Gene Names
MUK-binding inhibitory protein
UniProt Entry Name
MBIP1_HUMAN
Uniprot Description
MBIP: Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Protein kinase, regulatory subunit
Chromosomal Location of Human Ortholog: 14q13.3
Cellular Component: cytoplasm; nucleolus; nucleus
Molecular Function: identical protein binding; protein binding; protein kinase inhibitor activity
Biological Process: establishment and/or maintenance of chromatin architecture; inactivation of MAPK activity during osmolarity sensing
Similar Products
Product Notes
The MBIP mbip (Catalog #AAA3214746) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBIP Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MBIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MBIP mbip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQSVSFSGKR RKVQPPQQNY SLAELDEKIS ALKQALLRKS REAESMATHH. It is sometimes possible for the material contained within the vial of "MBIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
