Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using NHS antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human NHS Polyclonal Antibody | anti-NHS antibody
NHS Polyclonal Antibody
Gene Names
NHS; CXN; SCML1; CTRCT40
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NHS; Polyclonal Antibody; NHS Polyclonal Antibody; CTRCT40; CXN; SCML1; anti-NHS antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MDQKDDHQSSSGNWSGSSSTCPSQTSETIPPAASPPLTGSSHCDSELSLNTAPHANEDASVFVTEQYNDHLDKVRGHRANSFTSTVADLLDDPNNSNTSDSEWNYLHHHHDASCRQDFSPERPKADSLGCPSFTSMATYDSFLEKSPSDKADTSSHFSVDTEGYYTSMHFDCGLKGNKSYVCHYAALGPENGQGVGASPGLPDCAWQDYLDHKRQGRPSISFRKPKAKPTPPKRSSSLRKSDGNADISEKKEPKI
Sequence Length
1474
Applicable Applications for anti-NHS antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human NHS
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Apical cell membrane, Cell junction, Cell projection, Cytoplasm, Peripheral membrane protein, focal adhesion, lamellipodium, tight junction
Positive Samples
293T, Raji
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using NHS antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using NHS antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-NHS antibody
This gene encodes a protein containing four conserved nuclear localization signals. The encoded protein functions in eye, tooth, craniofacial and brain development, and it can regulate actin remodeling and cell morphology. Mutations in this gene have been shown to cause Nance-Horan syndrome, and also X-linked cataract-40. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-NHS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 160kDa; 176kDa; 179kDa
Observed: 179kDa
Observed: 179kDa
NCBI Official Full Name
Nance-Horan syndrome protein isoform 2
NCBI Official Synonym Full Names
NHS actin remodeling regulator
NCBI Official Symbol
NHS
NCBI Official Synonym Symbols
CXN; SCML1; CTRCT40
NCBI Protein Information
Nance-Horan syndrome protein
UniProt Protein Name
Nance-Horan syndrome protein
Protein Family
UniProt Gene Name
NHS
NCBI Description
This gene encodes a protein containing four conserved nuclear localization signals. The encoded protein functions in eye, tooth, craniofacial and brain development, and it can regulate actin remodeling and cell morphology. Mutations in this gene have been shown to cause Nance-Horan syndrome, and also X-linked cataract-40. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, May 2014]
Uniprot Description
May function in cell morphology by maintaining the integrity of the circumferential actin ring and controlling lamellipod formation. Involved in the regulation eye, tooth, brain and craniofacial development.
Research Articles on NHS
Similar Products
Product Notes
The NHS nhs (Catalog #AAA9135281) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NHS Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NHS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the NHS nhs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDQKDDHQSS SGNWSGSSST CPSQTSETIP PAASPPLTGS SHCDSELSLN TAPHANEDAS VFVTEQYNDH LDKVRGHRAN SFTSTVADLL DDPNNSNTSD SEWNYLHHHH DASCRQDFSP ERPKADSLGC PSFTSMATYD SFLEKSPSDK ADTSSHFSVD TEGYYTSMHF DCGLKGNKSY VCHYAALGPE NGQGVGASPG LPDCAWQDYL DHKRQGRPSI SFRKPKAKPT PPKRSSSLRK SDGNADISEK KEPKI. It is sometimes possible for the material contained within the vial of "NHS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
