Mouse anti-Human NFIA Monoclonal Antibody | anti-NFIA antibody
Anti-NFIA Antibody (monoclonal, 16H11)
Gene Names
NFIA; CTF; NF1-A; NFI-A; NFI-L; BRMUTD; NF-I/A
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
NFIA; Monoclonal Antibody; Anti-NFIA Antibody (monoclonal; 16H11); Nuclear factor 1 A-type; NF1-A; Nuclear factor 1/A; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/A; NF-I/A; NFI-A; TGGCA-binding protein; KIAA1439; Nuclear factor I A; anti-NFIA antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
16H11
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
498
Applicable Applications for anti-NFIA antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Flow Cytometry (FC/FACS)
Application Notes
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
FC/FACS: 1-3 mug/1x106 cells
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
IHC-P: 0.5-1 mug/ml
FC/FACS: 1-3 mug/1x106 cells
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -21 degree C for a longer time.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Related Product Information for anti-NFIA antibody
Description: Mouse IgG monoclonal antibody for NFIA detection. Tested with Tested with WB, IHC-P, FCM in Human.
Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
References
1. Leahy P, Crawford DR, Grossman G, et al. (1999). "CREB binding protein coordinates the function of multiple transcription factors including nuclear factor I to regulate phosphoenolpyruvate carboxykinase (GTP) gene transcription.". J. Biol. Chem. 274 (13): 8813-22. Qian F, Kruse U, Lichter P, Sippel AE (Dec 1995). "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH". Genomics 28 (1): 66-73.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,620 Da
NCBI Official Full Name
nuclear factor 1 A-type isoform 1
NCBI Official Synonym Full Names
nuclear factor I A
NCBI Official Symbol
NFIA
NCBI Official Synonym Symbols
CTF; NF1-A; NFI-A; NFI-L; BRMUTD; NF-I/A
NCBI Protein Information
nuclear factor 1 A-type
UniProt Protein Name
Nuclear factor 1 A-type
Protein Family
UniProt Gene Name
NFIA
UniProt Synonym Gene Names
KIAA1439; NF1-A; Nuclear factor 1/A; CTF; NF-I/A; NFI-A
NCBI Description
This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
Uniprot Description
Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
Research Articles on NFIA
Similar Products
Product Notes
The NFIA nfia (Catalog #AAA1752285) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-NFIA Antibody (monoclonal, 16H11) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFIA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Flow Cytometry (FC/FACS). WB: 0.1-0.5 mug/ml IHC-P: 0.5-1 mug/ml FC/FACS: 1-3 mug/1x106 cells Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Researchers should empirically determine the suitability of the NFIA nfia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFIA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
