Testing Data
(Annexin A3 antibody used at 1.25ug/ml to detect target protein.)
Rabbit ANXA3 Polyclonal Antibody | anti-ANXA3 antibody
ANXA3 (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (MaxLight 405)
Reactivity
Human, Canine
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANXA3; Polyclonal Antibody; ANXA3 (Annexin A3; Annexin-3; Annexin III; Lipocortin III; Placental Anticoagulant Protein III; PAP-III; 35-alpha Calcimedin; Inositol 1; 2-cyclic Phosphate 2-phosphohydrolase; ANX3) (MaxLight 405); anti-ANXA3 antibody
Host
Rabbit
Reactivity
Human, Canine
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes Annexin A3. Species Crossreactivity: Human and canine.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-ANXA3 antibody
Western Blot (WB)
Application Notes
WB: 1.25ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
C-terminus of ANXA3 corresponding to RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Annexin A3 antibody used at 1.25ug/ml to detect target protein.)
Testing Data
(Annexin A3 antibody used at 1.25ug/ml to detect target protein.)
Product Categories/Family for anti-ANXA3 antibody
Similar Products
Product Notes
The ANXA3 (Catalog #AAA6399596) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA3 (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (MaxLight 405) reacts with Human, Canine and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANXA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANXA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
