Mouse anti-Human NEUROD2 Monoclonal Antibody | anti-NEUROD2 antibody

NEUROD2 (Neurogenic Differentiation Factor 2, NeuroD2, Class A Basic Helix-loop-helix Protein 1, bHLHa1, NeuroD-related Factor, NDRF, BHLHA1, NDRF) (Biotin)

Cat. Num. AAA6143156

• Gene Names: NEUROD2; NDRF; bHLHa1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NEUROD2; Monoclonal Antibody; NEUROD2 (Neurogenic Differentiation Factor 2; NeuroD2; Class A Basic Helix-loop-helix Protein 1; bHLHa1; NeuroD-related Factor; NDRF; BHLHA1; NDRF) (Biotin); anti-NEUROD2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E7
• Specificity: Recognizes human NEUROD2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-NEUROD2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa266-375 from human NEUROD2 (NP_006151) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of NEUROD2 expression in transfected 293T cell line by NEUROD2 monoclonal antibody. Lane 1: NEUROD2 transfected lysate (41.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NEUROD2 antibody

NeuroD2 is a 41kD nuclear member of the neuroD family of transcription factors. It is expressed in developing and mature neurons such as hippocampal granular neurons, and acts (in part) to repress factors that would otherwise block multipotential cell commitment to a neuronal lineage. NeuroD2 is presumed to act as a heterodimer with other bHLH transcription factors. Human NeuroD2 is 382aa in length. It contains a poly-Glu region aa82-91, an NLS aa107-113, a DNA-binding HLH domain aa119-178 and a poly-Gly segment aa282-285. Based on rat studies, human NeuroD2 will undergo variable phosphorylation in the C-terminal region. Over aa174-382, human and mouse NeuroD2 possess identical aa sequences.

Product Categories/Family for anti-NEUROD2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 98986461
• NCBI GeneID: 4761
• NCBI Accession #: NP_006151
• NCBI GenBank Nucleotide #: NM_006160
• UniProt Accession #: Q15784
• Molecular Weight: 41kDa
• NCBI Official Full Name: neurogenic differentiation factor 2
• NCBI Official Synonym Full Names: neuronal differentiation 2
• NCBI Official Symbol: NEUROD2
• NCBI Official Synonym Symbols: NDRF; bHLHa1
• NCBI Protein Information: neurogenic differentiation factor 2
• UniProt Protein Name: Neurogenic differentiation factor 2
• Protein Family: Neurogenic differentiation factor
• UniProt Gene Name: NEUROD2
• UniProt Synonym Gene Names: BHLHA1; NDRF; NeuroD2; bHLHa1; NDRF
• UniProt Entry Name: NDF2_HUMAN

NCBI Description

This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq, Jul 2008]

Uniprot Description

NEUROD2: Transcriptional regulator implicated in neuronal determination. Mediates calcium-dependent transcription activation by binding to E box-containing promoter. Critical factor essential for the repression of the genetic program for neuronal differentiation; prevents the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Induces transcription of ZEB1, which in turn represses neuronal differentiation by down-regulating REST expression. Plays a role in the establishment and maturation of thalamocortical connections; involved in the segregation of thalamic afferents into distinct barrel domains within layer VI of the somatosensory cortex. Involved in the development of the cerebellar and hippocampal granular neurons, neurons in the basolateral nucleus of amygdala and the hypothalamic-pituitary axis. Associates with chromatin to the DPYSL3 E box-containing promoter.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: nucleus

Molecular Function: protein heterodimerization activity; transcription factor activity; transcription corepressor activity

Biological Process: nervous system development; behavioral fear response; transcription, DNA-dependent; positive regulation of synaptic plasticity; protein ubiquitination; positive regulation of calcium-mediated signaling; regulation of transcription from RNA polymerase II promoter; cerebellar cortex development; neuron development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of neuron differentiation; associative learning