Mouse anti-Human NEDD4L Monoclonal Antibody | anti-NEDD4L antibody

NEDD4L (Neural Precursor Cell Expressed, Developmentally Down-regulated 4-like, E3 Ubiquitin-protein Ligase NEDD4-like, FLJ33870, hNedd4-2, KIAA0439, NEDD4.2, Nedd4-2, NEDD4-2, NEDL3, RSP5) (MaxLight 750)

Cat. Num. AAA6234094

• Gene Names: NEDD4L; RSP5; NEDD4-2; NEDD4.2; hNEDD4-2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NEDD4L; Monoclonal Antibody; NEDD4L (Neural Precursor Cell Expressed; Developmentally Down-regulated 4-like; E3 Ubiquitin-protein Ligase NEDD4-like; FLJ33870; hNedd4-2; KIAA0439; NEDD4.2; Nedd4-2; NEDD4-2; NEDL3; RSP5) (MaxLight 750); anti-NEDD4L antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D2
• Specificity: Recognizes human NEDD4L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-NEDD4L antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from NEDD4L (AAH32597) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-NEDD4L antibody

NEDD4L is a member of the NEDD4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. NEDD4L mediates the ubiquitination of multiple target substrates and plays a critical role in epithelial sodium transport by regulating the cell surface expression of the epithelial sodium channel, ENaC. Single nucleotide polymorphisms in this protein may be associated with essential hypertension.

Product Categories/Family for anti-NEDD4L antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 21619659
• NCBI GeneID: 23327
• Molecular Weight: 96,271 Da
• NCBI Official Full Name: Homo sapiens neural cell expressed, developmentally down-regulated 4-like, mRNA
• NCBI Official Synonym Full Names: neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
• NCBI Official Symbol: NEDD4L
• NCBI Official Synonym Symbols: RSP5; NEDD4-2; NEDD4.2; hNEDD4-2
• NCBI Protein Information: E3 ubiquitin-protein ligase NEDD4-like
• Protein Family: E3 ubiquitin-protein ligase

NCBI Description

This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein mediates the ubiquitination of multiple target substrates and plays a critical role in epithelial sodium transport by regulating the cell surface expression of the epithelial sodium channel, ENaC. Single nucleotide polymorphisms in this gene may be associated with essential hypertension. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]