Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human NEDD4L Monoclonal Antibody | anti-NEDD4L antibody

NEDD4L (Neural Precursor Cell Expressed, Developmentally Down-regulated 4-like, E3 Ubiquitin-protein Ligase NEDD4-like, FLJ33870, hNedd4-2, KIAA0439, NEDD4.2, Nedd4-2, NEDD4-2, NEDL3, RSP5) (AP)

Gene Names
NEDD4L; RSP5; NEDD4-2; NEDD4.2; hNEDD4-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NEDD4L; Monoclonal Antibody; NEDD4L (Neural Precursor Cell Expressed; Developmentally Down-regulated 4-like; E3 Ubiquitin-protein Ligase NEDD4-like; FLJ33870; hNedd4-2; KIAA0439; NEDD4.2; Nedd4-2; NEDD4-2; NEDL3; RSP5) (AP); anti-NEDD4L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D2
Specificity
Recognizes human NEDD4L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NEDD4L antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from NEDD4L (AAH32597) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of NEDD4L expression in transfected 293T cell line by NEDD4L monoclonal antibody. Lane 1: NEDD4L transfected lysate (Predicted MW: 104.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NEDD4L expression in transfected 293T cell line by NEDD4L monoclonal antibody. Lane 1: NEDD4L transfected lysate (Predicted MW: 104.9kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NEDD4L transfected lysate using NEDD4L monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEDD4L monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NEDD4L transfected lysate using NEDD4L monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEDD4L monoclonal antibody.)
Related Product Information for anti-NEDD4L antibody
NEDD4L is a member of the NEDD4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. NEDD4L mediates the ubiquitination of multiple target substrates and plays a critical role in epithelial sodium transport by regulating the cell surface expression of the epithelial sodium channel, ENaC. Single nucleotide polymorphisms in this protein may be associated with essential hypertension.
Product Categories/Family for anti-NEDD4L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
96,271 Da
NCBI Official Full Name
Homo sapiens neural cell expressed, developmentally down-regulated 4-like, mRNA
NCBI Official Synonym Full Names
neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
NCBI Official Symbol
NEDD4L
NCBI Official Synonym Symbols
RSP5; NEDD4-2; NEDD4.2; hNEDD4-2
NCBI Protein Information
E3 ubiquitin-protein ligase NEDD4-like

NCBI Description

This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein mediates the ubiquitination of multiple target substrates and plays a critical role in epithelial sodium transport by regulating the cell surface expression of the epithelial sodium channel, ENaC. Single nucleotide polymorphisms in this gene may be associated with essential hypertension. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Research Articles on NEDD4L

Similar Products

Product Notes

The NEDD4L (Catalog #AAA6132531) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEDD4L (Neural Precursor Cell Expressed, Developmentally Down-regulated 4-like, E3 Ubiquitin-protein Ligase NEDD4-like, FLJ33870, hNedd4-2, KIAA0439, NEDD4.2, Nedd4-2, NEDD4-2, NEDL3, RSP5) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEDD4L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEDD4L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEDD4L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.