Western Blot (WB)
(WB Suggested Anti-UGT2A3 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Rabbit anti-Human UGT2A3 Polyclonal Antibody | anti-UGT2A3 antibody
UGT2A3 antibody - N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UGT2A3; Polyclonal Antibody; UGT2A3 antibody - N-terminal region; anti-UGT2A3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN
Sequence Length
527
Applicable Applications for anti-UGT2A3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UGT2A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-UGT2A3 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-UGT2A3 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-UGT2A3 antibody
This is a rabbit polyclonal antibody against UGT2A3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
Target Description: UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
Product Categories/Family for anti-UGT2A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
UDP-glucuronosyltransferase 2A3
NCBI Official Synonym Full Names
UDP glucuronosyltransferase family 2 member A3
NCBI Official Symbol
UGT2A3
NCBI Protein Information
UDP-glucuronosyltransferase 2A3
UniProt Protein Name
UDP-glucuronosyltransferase 2A3
Protein Family
UniProt Gene Name
UGT2A3
UniProt Synonym Gene Names
UNQ2559/PRO6239; UDPGT 2A3
UniProt Entry Name
UD2A3_HUMAN
Research Articles on UGT2A3
Similar Products
Product Notes
The UGT2A3 ugt2a3 (Catalog #AAA3209673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UGT2A3 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UGT2A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UGT2A3 ugt2a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVKVILEELI VRGHEVTVLT HSKPSLIDYR KPSALKFEVV HMPQDRTEEN. It is sometimes possible for the material contained within the vial of "UGT2A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
