Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.66kD).)

Mouse anti-Human NDUFA8 Monoclonal Antibody | anti-NDUFA8 antibody

NDUFA8 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 8, Complex I-19kD, CI-19kD, Complex I-PGIV, CI-PGIV, NADH-ubiquinone Oxidoreductase 19kD Subunit, MGC793) (HRP)

Gene Names
NDUFA8; PGIV; CI-19KD; CI-PGIV
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFA8; Monoclonal Antibody; NDUFA8 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 8; Complex I-19kD; CI-19kD; Complex I-PGIV; CI-PGIV; NADH-ubiquinone Oxidoreductase 19kD Subunit; MGC793) (HRP); anti-NDUFA8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E10
Specificity
Recognizes human NDUFA8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NDUFA8 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-72 from NDUFA8 (NP_055037) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.66kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.66kD).)

Western Blot (WB)

(Western Blot analysis of NDUFA8 expression in transfected 293T cell line by NDUFA8 monoclonal antibody. Lane 1: NDUFA8 transfected lysate (Predicted MW: 20.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFA8 expression in transfected 293T cell line by NDUFA8 monoclonal antibody. Lane 1: NDUFA8 transfected lysate (Predicted MW: 20.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NDUFA8 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NDUFA8 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-NDUFA8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A8
NCBI Official Symbol
NDUFA8
NCBI Official Synonym Symbols
PGIV; CI-19KD; CI-PGIV
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Protein Family
UniProt Gene Name
NDUFA8
UniProt Synonym Gene Names
CI-19kD; CI-PGIV
UniProt Entry Name
NDUA8_HUMAN

NCBI Description

The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Uniprot Description

NDUFA8: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFA8 subunit family.

Protein type: Mitochondrial; Energy Metabolism - oxidative phosphorylation; EC 1.6.5.3; EC 1.6.99.3; Oxidoreductase

Chromosomal Location of Human Ortholog: 9q33.2

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity; protein complex binding

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFA8

Similar Products

Product Notes

The NDUFA8 ndufa8 (Catalog #AAA6153728) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFA8 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 8, Complex I-19kD, CI-19kD, Complex I-PGIV, CI-PGIV, NADH-ubiquinone Oxidoreductase 19kD Subunit, MGC793) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFA8 ndufa8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFA8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.