Mouse ND1 Monoclonal Antibody | anti-ND1 antibody

ND1 (NADH Dehydrogenase, Subunit 1 (Complex I), MTND1) (PE)

Cat. Num. AAA6187921

• Gene Names: MT-ND1; MTND1; ND1
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: ND1; Monoclonal Antibody; ND1 (NADH Dehydrogenase; Subunit 1 (Complex I); MTND1) (PE); NADH Dehydrogenase; MTND1; anti-ND1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H3
• Specificity: Recognizes ND1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 318

• Applicable Applications for anti-ND1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ND1 (YP_003024026, 21aa-71aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITLY
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ND1 is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-ND1 antibody

Mouse monoclonal antibody raised against a partial recombinant ND1.

Product Categories/Family for anti-ND1 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 251831107
• NCBI GeneID: 4535
• NCBI Accession #: YP_003024026
• NCBI GenBank Nucleotide #: YP_003024026.1
• UniProt Accession #: P03886
• NCBI Official Full Name: NADH dehydrogenase subunit 1 (mitochondrion)
• NCBI Official Synonym Full Names: mitochondrially encoded NADH dehydrogenase 1
• NCBI Official Symbol: MT-ND1
• NCBI Official Synonym Symbols: MTND1; ND1
• NCBI Protein Information: NADH dehydrogenase, subunit 1 (complex I)
• UniProt Protein Name: NADH-ubiquinone oxidoreductase chain 1
• Protein Family: NADH-ubiquinone oxidoreductase
• UniProt Gene Name: MT-ND1
• UniProt Synonym Gene Names: MTND1; NADH1; ND1
• UniProt Entry Name: NU1M_HUMAN

Uniprot Description

MT-ND1: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Defects in MT-ND1 are a cause of Leber hereditary optic neuropathy (LHON). LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes. Defects in MT-ND1 are a cause of mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS). MELAS is a genetically heterogenious disorder, characterized by episodic vomiting, seizures, and recurrent cerebral insults resembling strokes and causing hemiparesis, hemianopsia, or cortical blindness. Defects in MT-ND1 may be associated with susceptibility to Alzheimer disease mitochondrial (AD-MT). Alzheimer disease is a neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death. Genetic variation in MT-ND1 might contribute ot the pathogenesis of non-insulin-dependent diabetes mellitus (NIDDM). Belongs to the complex I subunit 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Mitochondrial; Energy Metabolism - oxidative phosphorylation; Oxidoreductase; EC 1.6.5.3

Chromosomal Location of Human Ortholog: -

Disease: Mitochondrial Myopathy, Encephalopathy, Lactic Acidosis, And Stroke-like Episodes; Leber Optic Atrophy