Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NBN is 0.3 ng/ml as a capture antibody.)

Mouse NBN Monoclonal Antibody | anti-NBN antibody

NBN (Nibrin, AT-V1, AT-V2, ATV, FLJ10155, MGC87362, NBS, NBS1, P95) (PE)

Gene Names
NBN; ATV; NBS; P95; NBS1; AT-V1; AT-V2
Applications
Western Blot
Purity
Purified
Synonyms
NBN; Monoclonal Antibody; NBN (Nibrin; AT-V1; AT-V2; ATV; FLJ10155; MGC87362; NBS; NBS1; P95) (PE); Nibrin; P95; anti-NBN antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C7
Specificity
Recognizes NBN.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NBN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NBN (NP_002476, 645aa-754aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NBN is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NBN is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-NBN antibody
Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. [provided by RefSeq]
Product Categories/Family for anti-NBN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,959 Da
NCBI Official Full Name
nibrin
NCBI Official Synonym Full Names
nibrin
NCBI Official Symbol
NBN
NCBI Official Synonym Symbols
ATV; NBS; P95; NBS1; AT-V1; AT-V2
NCBI Protein Information
nibrin; cell cycle regulatory protein p95; Nijmegen breakage syndrome 1 (nibrin); p95 protein of the MRE11/RAD50 complex
UniProt Protein Name
Nibrin
Protein Family
UniProt Gene Name
NBN
UniProt Synonym Gene Names
NBS; NBS1; P95
UniProt Entry Name
NBN_HUMAN

NCBI Description

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. [provided by RefSeq, Jul 2008]

Uniprot Description

NBS1: a member of the MRE11/RAD50 double-strand break repair complex. Involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. Mutation results in the Nijmegen breakage syndrome (NBS), an autosomal recessive chromosomal instability syndrome.

Protein type: Cell cycle regulation; DNA repair, damage

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: nucleoplasm; PML body; Mre11 complex; nuclear chromosome, telomeric region; nucleolus; replication fork; nucleus; nuclear inclusion body

Molecular Function: ATP-dependent DNA helicase activity; protein binding; damaged DNA binding; protein N-terminus binding; transcription factor binding

Biological Process: DNA damage response, signal transduction by p53 class mediator; mitotic cell cycle checkpoint; positive regulation of kinase activity; isotype switching; DNA repair; positive regulation of protein amino acid autophosphorylation; DNA duplex unwinding; double-strand break repair via homologous recombination; regulation of DNA replication initiation; cell proliferation; meiotic cell cycle; double-strand break repair; mitotic cell cycle G2/M transition DNA damage checkpoint; DNA damage checkpoint; blastocyst growth; cell cycle arrest; neuromuscular process controlling balance; telomere maintenance

Disease: Leukemia, Acute Lymphoblastic; Nijmegen Breakage Syndrome; Aplastic Anemia

Research Articles on NBN

Similar Products

Product Notes

The NBN nbn (Catalog #AAA6187144) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NBN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NBN nbn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NBN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.