Mouse anti-Human NANS Monoclonal Antibody | anti-NANS antibody

NANS (Sialic Acid Synthase, N-Acetylneuraminate Synthase, N-acetylneuraminic Acid Synthase, N-acetylneuraminate-9-phosphate Synthase, N-acetylneuraminic Acid Phosphate Synthase, SAS) (FITC)

Cat. Num. AAA6148391

• Gene Names: NANS; SAS; SEMDG; SEMDCG; HEL-S-100
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NANS; Monoclonal Antibody; NANS (Sialic Acid Synthase; N-Acetylneuraminate Synthase; N-acetylneuraminic Acid Synthase; N-acetylneuraminate-9-phosphate Synthase; N-acetylneuraminic Acid Phosphate Synthase; SAS) (FITC); anti-NANS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G6
• Specificity: Recognizes human NANS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NANS antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa260-360 from human NANS (NP_061819) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(NANS monoclonal antibody, Western Blot analysis of NANS expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged NANS is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-NANS antibody

This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq]

Product Categories/Family for anti-NANS antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 12056473
• NCBI GeneID: 54187
• NCBI Accession #: NP_061819
• NCBI GenBank Nucleotide #: NM_018946
• UniProt Accession #: Q9NR45; Q8WUV9; Q9BWS6; Q9NVD4; B2RE98
• Molecular Weight: 40,308 Da
• NCBI Official Full Name: sialic acid synthase
• NCBI Official Synonym Full Names: N-acetylneuraminate synthase
• NCBI Official Symbol: NANS
• NCBI Official Synonym Symbols: SAS; SEMDG; SEMDCG; HEL-S-100
• NCBI Protein Information: sialic acid synthase
• UniProt Protein Name: Sialic acid synthase
• Protein Family: Sialic acid synthase
• UniProt Gene Name: NANS
• UniProt Synonym Gene Names: SAS
• UniProt Entry Name: SIAS_HUMAN

NCBI Description

This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq, Jul 2008]

Uniprot Description

NANS: Produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3- deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N- acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.

Protein type: EC 2.5.1.57; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Transferase; EC 2.5.1.56

Chromosomal Location of Human Ortholog: 9p24.1-p23

Cellular Component: cytoplasm; cytosol

Molecular Function: N-acylneuraminate-9-phosphate synthase activity; N-acetylneuraminate synthase activity; N-acylneuraminate cytidylyltransferase activity

Biological Process: cellular protein metabolic process; dolichol-linked oligosaccharide biosynthetic process; lipopolysaccharide biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification