Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human NANOG Monoclonal Antibody | anti-NANOG antibody

NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451) (FITC)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NANOG; Monoclonal Antibody; NANOG (Homeobox Protein NANOG; Homeobox Transcription Factor Nanog; hNanog; FLJ12581; FLJ40451) (FITC); anti-NANOG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C11
Specificity
Recognizes human NANOG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NANOG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa98-196 from human NANOG (NP_079141) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(NANOG monoclonal antibody, Western Blot analysis of NANOG expression in Hela NE.)

Western Blot (WB) (NANOG monoclonal antibody, Western Blot analysis of NANOG expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged NANOG is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NANOG is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-NANOG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,838 Da
NCBI Official Full Name
homeobox protein NANOG isoform 1
NCBI Official Synonym Full Names
Nanog homeobox
NCBI Official Symbol
NANOG
NCBI Protein Information
homeobox protein NANOG
UniProt Protein Name
Homeobox protein NANOG
Protein Family
UniProt Gene Name
NANOG
UniProt Synonym Gene Names
hNanog
UniProt Entry Name
NANOG_HUMAN

NCBI Description

The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

NANOG: Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. When overexpressed, promotes cells to enter into S phase and proliferation. Interacts with SMAD1 and SALL4. Expressed in testicular carcinoma and derived germ cell tumors. Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes. Belongs to the Nanog homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Cell development/differentiation

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: DNA binding; chromatin binding; transcription factor activity; transcription corepressor activity

Biological Process: response to retinoic acid; gonad development; transcription, DNA-dependent; somatic stem cell maintenance; stem cell division; endodermal cell fate specification; stem cell maintenance; negative regulation of transcription from RNA polymerase II promoter; positive regulation of mitotic cell cycle; embryonic pattern specification; mesodermal cell fate commitment; negative regulation of cell fate commitment; negative regulation of BMP signaling pathway; cell proliferation; regulation of transcription, DNA-dependent; regulation of gene expression; regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; cell differentiation

Research Articles on NANOG

Similar Products

Product Notes

The NANOG nanog (Catalog #AAA6148390) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NANOG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NANOG nanog for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NANOG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.