Western Blot (WB)
(NAGK monoclonal antibody. Western Blot analysis of NAGK expression in HepG2.)
Mouse anti-Human, Mouse NAGK Monoclonal Antibody | anti-NAGK antibody
NAGK (N-Acetylglucosamine Kinase, N-acetyl-D-glucosamine Kinase, GlcNAc Kinase, GNK, HSA242910) (Biotin)
Gene Names
NAGK; GNK; HSA242910
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NAGK; Monoclonal Antibody; NAGK (N-Acetylglucosamine Kinase; N-acetyl-D-glucosamine Kinase; GlcNAc Kinase; GNK; HSA242910) (Biotin); anti-NAGK antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1H8
Specificity
Recognizes human NAGK. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NAGK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-345 from human NAGK (AAH01029) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(NAGK monoclonal antibody. Western Blot analysis of NAGK expression in HepG2.)
Western Blot (WB)
(NAGK monoclonal antibody. Western Blot analysis of NAGK expression in HepG2.)
Western Blot (WB)
(NAGK monoclonal antibody. Western Blot analysis of NAGK expression in Raw 264.7.)
Western Blot (WB)
(NAGK monoclonal antibody. Western Blot analysis of NAGK expression in Raw 264.7.)
Product Categories/Family for anti-NAGK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
42,038 Da
NCBI Official Full Name
Homo sapiens N-acetylglucosamine kinase, mRNA
NCBI Official Synonym Full Names
N-acetylglucosamine kinase
NCBI Official Symbol
NAGK
NCBI Official Synonym Symbols
GNK; HSA242910
NCBI Protein Information
N-acetyl-D-glucosamine kinase
Protein Family
NCBI Description
This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars. [provided by RefSeq, Nov 2011]
Research Articles on NAGK
Similar Products
Product Notes
The NAGK (Catalog #AAA6143085) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NAGK (N-Acetylglucosamine Kinase, N-acetyl-D-glucosamine Kinase, GlcNAc Kinase, GNK, HSA242910) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NAGK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAGK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAGK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
