Mouse anti-Human Myotubular Myopathy 1 Monoclonal Antibody | anti-MTM1 antibody

Myotubular Myopathy 1 (MTM1, CNM, MTMX, Myotubularin, XLMTM, CG2, Myotubularin 1) (PE)

Cat. Num. AAA6158980

• Gene Names: MTM1; CNM; MTMX; XLMTM
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Myotubular Myopathy 1; Monoclonal Antibody; Myotubular Myopathy 1 (MTM1; CNM; MTMX; Myotubularin; XLMTM; CG2; Myotubularin 1) (PE); anti-MTM1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C10
• Specificity: Recognizes human MTM1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MTM1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human MTM1 (AAH30779) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNYRLYLRSLETDSSLILDVPLGVISRIEKMGGAT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of MTM1 expression in transfected 293T cell line by MTM1 monoclonal antibody. Lane 1: MTM1 transfected lysate (69.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MTM1 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MTM1 over-expressed 293 cell line, cotransfected with MTM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MTM1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-MTM1 antibody

Antibodies; Protein Phosphatases

References

1. Myopathy in a woman and her daughter associated with a novel splice site MTM1 mutation. Hedberg C, Lindberg C, Mathe G, Moslemi AR, Oldfors A.Neuromuscul Disord. 2011 Nov 17.

NCBI and Uniprot Product Information

• NCBI GI #: 21314968
• NCBI GeneID: 4534
• Molecular Weight: 66,053 Da
• NCBI Official Full Name: Homo sapiens myotubularin 1, mRNA
• NCBI Official Synonym Full Names: myotubularin 1
• NCBI Official Symbol: MTM1
• NCBI Official Synonym Symbols: CNM; MTMX; XLMTM
• NCBI Protein Information: myotubularin
• Protein Family: Myotubularin

NCBI Description

This gene encodes a dual-specificity phosphatase that acts on both phosphotyrosine and phosphoserine. It is required for muscle cell differentiation and mutations in this gene have been identified as being responsible for X-linked myotubular myopathy. [provided by RefSeq, Jul 2008]