Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Mouse MYL6 Monoclonal Antibody | anti-MYL6 antibody

MYL6 (Myosin Light Polypeptide 6, 17kD Myosin Light Chain, Myosin Light Chain 3, Myosin Light Chain Alkali 3, Smooth Muscle and Nonmuscle Myosin Light Chain Alkali 6) (MaxLight 750)

Gene Names
MYL6; LC17; ESMLC; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM; LC17-GI; LC17-NM
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYL6; Monoclonal Antibody; MYL6 (Myosin Light Polypeptide 6; 17kD Myosin Light Chain; Myosin Light Chain 3; Myosin Light Chain Alkali 3; Smooth Muscle and Nonmuscle Myosin Light Chain Alkali 6) (MaxLight 750); anti-MYL6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D6
Specificity
Recognizes human MYL6. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
151
Applicable Applications for anti-MYL6 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human MYL6 (NP_066299) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEG
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MYL6 antibody
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
Product Categories/Family for anti-MYL6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
myosin light polypeptide 6 isoform 1
NCBI Official Synonym Full Names
myosin light chain 6
NCBI Official Symbol
MYL6
NCBI Official Synonym Symbols
LC17; ESMLC; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM; LC17-GI; LC17-NM
NCBI Protein Information
myosin light polypeptide 6
UniProt Protein Name
Myosin light polypeptide 6
Protein Family
UniProt Gene Name
MYL6
UniProt Synonym Gene Names
LC17; MLC-3
UniProt Entry Name
MYL6_HUMAN

NCBI Description

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MYL6: Regulatory light chain of myosin. Does not bind calcium. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Motor

Chromosomal Location of Human Ortholog: 12q13.2

Cellular Component: membrane; unconventional myosin complex; myosin complex; cytosol; vesicle

Molecular Function: protein binding; structural constituent of muscle; motor activity; calcium ion binding; actin-dependent ATPase activity

Biological Process: axon guidance; skeletal muscle development; muscle contraction; metabolic process; ephrin receptor signaling pathway; muscle filament sliding

Similar Products

Product Notes

The MYL6 myl6 (Catalog #AAA6234013) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYL6 (Myosin Light Polypeptide 6, 17kD Myosin Light Chain, Myosin Light Chain 3, Myosin Light Chain Alkali 3, Smooth Muscle and Nonmuscle Myosin Light Chain Alkali 6) (MaxLight 750) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MYL6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYL6 myl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYL6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.