Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human MYCN Monoclonal Antibody | anti-MYCN antibody

MYCN (N-myc Proto-oncogene Protein, Class E Basic Helix-loop-helix Protein 37, bHLHe37, BHLHE37, NMYC) (HRP)

Gene Names
MYCN; NMYC; ODED; MODED; N-myc; bHLHe37
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYCN; Monoclonal Antibody; MYCN (N-myc Proto-oncogene Protein; Class E Basic Helix-loop-helix Protein 37; bHLHe37; BHLHE37; NMYC) (HRP); anti-MYCN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H4
Specificity
Recognizes human MYCN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MYCN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human MYCN (NP_005369) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(MYCN monoclonal antibody Western Blot analysis of MYCN expression in HepG2.)

Western Blot (WB) (MYCN monoclonal antibody Western Blot analysis of MYCN expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of MYCN expression in transfected 293T cell line by MYCN monoclonal antibody. Lane 1: MYCN transfected lysate (49.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MYCN expression in transfected 293T cell line by MYCN monoclonal antibody. Lane 1: MYCN transfected lysate (49.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MYCN is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MYCN is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MYCN over-expressed 293 cell line, cotransfected with MYCN Validated Chimera RNA (Lane 2) or non-transfected control (Lane 1). Blot probed with MYCN monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of MYCN over-expressed 293 cell line, cotransfected with MYCN Validated Chimera RNA (Lane 2) or non-transfected control (Lane 1). Blot probed with MYCN monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-MYCN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
N-myc proto-oncogene protein isoform 1
NCBI Official Synonym Full Names
MYCN proto-oncogene, bHLH transcription factor
NCBI Official Symbol
MYCN
NCBI Official Synonym Symbols
NMYC; ODED; MODED; N-myc; bHLHe37
NCBI Protein Information
N-myc proto-oncogene protein
UniProt Protein Name
N-myc proto-oncogene protein
Protein Family
UniProt Gene Name
MYCN
UniProt Synonym Gene Names
BHLHE37; NMYC; bHLHe37
UniProt Entry Name
MYCN_HUMAN

NCBI Description

This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

Uniprot Description

N-Myc: a proto-oncogenic transcription factor. Plays a role in cell proliferation, apoptosis and in the development of human tumors.

Protein type: Oncoprotein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 2p24.3

Cellular Component: nucleus; chromatin

Molecular Function: protein dimerization activity; protein binding; DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; branching morphogenesis of a tube; negative regulation of astrocyte differentiation; positive regulation of mesenchymal cell proliferation; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; embryonic skeletal morphogenesis; cartilage condensation; lung development

Disease: Feingold Syndrome 1; Tracheoesophageal Fistula With Or Without Esophageal Atresia

Research Articles on MYCN

Similar Products

Product Notes

The MYCN mycn (Catalog #AAA6153654) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYCN (N-myc Proto-oncogene Protein, Class E Basic Helix-loop-helix Protein 37, bHLHe37, BHLHE37, NMYC) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYCN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYCN mycn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYCN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.