Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HOXA7Sample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit HOXA7 Polyclonal Antibody | anti-HOXA7 antibody

HOXA7 Antibody - C-terminal region

Gene Names
HOXA7; ANTP; HOX1; HOX1A; HOX1.1
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HOXA7; Polyclonal Antibody; HOXA7 Antibody - C-terminal region; anti-HOXA7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE
Sequence Length
230
Applicable Applications for anti-HOXA7 antibody
Western Blot (WB)
Homology
Dog: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 79%; Sheep: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HOXA7Sample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HOXA7Sample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HOXA7 antibody
This is a rabbit polyclonal antibody against HOXA7. It was validated on Western Blot

Target Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
homeobox protein Hox-A7
NCBI Official Synonym Full Names
homeobox A7
NCBI Official Symbol
HOXA7
NCBI Official Synonym Symbols
ANTP; HOX1; HOX1A; HOX1.1
NCBI Protein Information
homeobox protein Hox-A7
UniProt Protein Name
Homeobox protein Hox-A7
Protein Family
UniProt Gene Name
HOXA7
UniProt Synonym Gene Names
HOX1A
UniProt Entry Name
HXA7_HUMAN

NCBI Description

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXA7: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family.

Protein type: Motility/polarity/chemotaxis; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 7p15.2

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; transcription factor binding

Biological Process: anterior/posterior pattern formation; transcription, DNA-dependent; negative regulation of keratinocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; angiogenesis; stem cell differentiation; negative regulation of cell-matrix adhesion; negative regulation of monocyte differentiation; negative regulation of transcription, DNA-dependent; negative regulation of leukocyte migration; embryonic skeletal morphogenesis

Research Articles on HOXA7

Similar Products

Product Notes

The HOXA7 hoxa7 (Catalog #AAA3213698) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXA7 Antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HOXA7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HOXA7 hoxa7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKIWFQNRRM KWKKEHKDEG PTAAAAPEGA VPSAAATAAA DKADEEDDDE. It is sometimes possible for the material contained within the vial of "HOXA7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.