Mouse MYBL2 Monoclonal Antibody | anti-MYBL2 antibody

MYBL2 (v-myb Myeloblastosis Viral Oncogene Homolog (avian)-like 2, B-MYB, BMYB, MGC15600) (APC)

Cat. Num. AAA6166933

• Gene Names: MYBL2; BMYB; B-MYB
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MYBL2; Monoclonal Antibody; MYBL2 (v-myb Myeloblastosis Viral Oncogene Homolog (avian)-like 2; B-MYB; BMYB; MGC15600) (APC); v-myb Myeloblastosis Viral Oncogene Homolog (avian)-like 2; MGC15600; anti-MYBL2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5G5
• Specificity: Recognizes MYBL2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 700

• Applicable Applications for anti-MYBL2 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MYBL2 (AAH53555, 601aa-700aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MYBL2 monoclonal antibody (M03), clone 5G5 Western Blot analysis of MYBL2 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MYBL2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MYBL2 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MYBL2 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-MYBL2 antibody

The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined. [provided by RefSeq]

Product Categories/Family for anti-MYBL2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 31565776
• NCBI GeneID: 4605
• NCBI Official Full Name: V-myb myeloblastosis viral oncogene homolog (avian)-like 2
• NCBI Official Synonym Full Names: MYB proto-oncogene like 2
• NCBI Official Symbol: MYBL2
• NCBI Official Synonym Symbols: BMYB; B-MYB
• NCBI Protein Information: myb-related protein B
• Protein Family: Myb-related protein

NCBI Description

The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013]