Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody. Lane 1: MTMR1 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human MTMR1 Monoclonal Antibody | anti-MTMR1 antibody

MTMR1 (Myotubularin-related Protein 1) (PE)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MTMR1; Monoclonal Antibody; MTMR1 (Myotubularin-related Protein 1) (PE); anti-MTMR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F10
Specificity
Recognizes human MTMR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MTMR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa39-113 from MTMR1 (NP_003819) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody. Lane 1: MTMR1 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody. Lane 1: MTMR1 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MTMR1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MTMR1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-MTMR1 antibody
Lipid phosphatase that acts on phosphatidylinositol 3-phosphate and phosphatidylinositol (3,5)-bisphosphate.
Product Categories/Family for anti-MTMR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,330 Da
NCBI Official Full Name
myotubularin-related protein 1
NCBI Official Synonym Full Names
myotubularin related protein 1
NCBI Official Symbol
MTMR1
NCBI Protein Information
myotubularin-related protein 1; phosphatidylinositol-3-phosphate phosphatase
UniProt Protein Name
Myotubularin-related protein 1
UniProt Gene Name
MTMR1
UniProt Entry Name
MTMR1_HUMAN

NCBI Description

This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

MTMR1: Lipid phosphatase that acts on phosphatidylinositol 3- phosphate and phosphatidylinositol (3,5)-bisphosphate. Belongs to the protein-tyrosine phosphatase family. Non-receptor class myotubularin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.64; Carbohydrate Metabolism - fructose and mannose; Protein phosphatase, tyrosine (non-receptor); Phosphatase, lipid; Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - thiamine; Cofactor and Vitamin Metabolism - riboflavin

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: cytoplasm; plasma membrane; cytosol

Molecular Function: phosphatidylinositol-3-phosphatase activity; protein tyrosine phosphatase activity

Biological Process: phospholipid metabolic process; phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation

Research Articles on MTMR1

Similar Products

Product Notes

The MTMR1 mtmr1 (Catalog #AAA6158932) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTMR1 (Myotubularin-related Protein 1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTMR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTMR1 mtmr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTMR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.