Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human MTHFS Monoclonal Antibody | anti-MTHFS antibody

MTHFS (5-formyltetrahydrofolate Cyclo-Ligase, 5,10-Methenyl-Tetrahydrofolate Synthetase, Methenyl-THF Synthetase) (PE)

Gene Names
MTHFS; NEDMEHM; HsT19268
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MTHFS; Monoclonal Antibody; MTHFS (5-formyltetrahydrofolate Cyclo-Ligase; 5; 10-Methenyl-Tetrahydrofolate Synthetase; Methenyl-THF Synthetase) (PE); anti-MTHFS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C12
Specificity
Recognizes human MTHFS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2301
Applicable Applications for anti-MTHFS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa104-203 from MTHFS (NP_006432) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(MTHFS monoclonal antibody Western Blot analysis of MTHFS expression in HeLa.)

Western Blot (WB) (MTHFS monoclonal antibody Western Blot analysis of MTHFS expression in HeLa.)
Related Product Information for anti-MTHFS antibody
Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.
Product Categories/Family for anti-MTHFS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens methenyltetrahydrofolate synthetase (MTHFS), transcript variant 1, mRNA
NCBI Official Synonym Full Names
methenyltetrahydrofolate synthetase
NCBI Official Symbol
MTHFS
NCBI Official Synonym Symbols
NEDMEHM; HsT19268
NCBI Protein Information
5-formyltetrahydrofolate cyclo-ligase
UniProt Protein Name
5-formyltetrahydrofolate cyclo-ligase
UniProt Gene Name
MTHFS
UniProt Synonym Gene Names
MTHFS; Methenyl-THF synthetase
UniProt Entry Name
MTHFS_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.

Research Articles on MTHFS

Similar Products

Product Notes

The MTHFS mthfs (Catalog #AAA6158930) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTHFS (5-formyltetrahydrofolate Cyclo-Ligase, 5,10-Methenyl-Tetrahydrofolate Synthetase, Methenyl-THF Synthetase) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTHFS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTHFS mthfs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTHFS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.