Mouse anti-Human MTHFS Monoclonal Antibody | anti-MTHFS antibody

MTHFS (5-formyltetrahydrofolate Cyclo-Ligase, 5,10-Methenyl-Tetrahydrofolate Synthetase, Methenyl-THF Synthetase) (FITC)

Cat. Num. AAA6148324

• Gene Names: MTHFS; NEDMEHM; HsT19268
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MTHFS; Monoclonal Antibody; MTHFS (5-formyltetrahydrofolate Cyclo-Ligase; 5; 10-Methenyl-Tetrahydrofolate Synthetase; Methenyl-THF Synthetase) (FITC); anti-MTHFS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C12
• Specificity: Recognizes human MTHFS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 2301

• Applicable Applications for anti-MTHFS antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa104-203 from MTHFS (NP_006432) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(MTHFS monoclonal antibody Western Blot analysis of MTHFS expression in HeLa.)

Related Product Information for anti-MTHFS antibody

Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.

Product Categories/Family for anti-MTHFS antibody

Antibodies; Enzymes; Synthetase

NCBI and Uniprot Product Information

• NCBI GI #: 1779541888
• NCBI GeneID: 10588
• NCBI Accession #: NM_006441.4
• NCBI GenBank Nucleotide #: NM_006441
• UniProt Accession #: P49914
• NCBI Official Full Name: Homo sapiens methenyltetrahydrofolate synthetase (MTHFS), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: methenyltetrahydrofolate synthetase
• NCBI Official Symbol: MTHFS
• NCBI Official Synonym Symbols: NEDMEHM; HsT19268
• NCBI Protein Information: 5-formyltetrahydrofolate cyclo-ligase
• UniProt Protein Name: 5-formyltetrahydrofolate cyclo-ligase
• UniProt Gene Name: MTHFS
• UniProt Synonym Gene Names: MTHFS; Methenyl-THF synthetase
• UniProt Entry Name: MTHFS_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.