Mouse MTA1 Monoclonal Antibody | anti-MTA1 antibody

MTA1 (Metastasis Associated 1) (HRP)

Cat. Num. AAA6183006

• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MTA1; Monoclonal Antibody; MTA1 (Metastasis Associated 1) (HRP); Metastasis Associated 1; anti-MTA1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D4
• Specificity: Recognizes MTA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 715

• Applicable Applications for anti-MTA1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MTA1 (NP_004680, 601aa-700aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MTA1 monoclonal antibody (M03), clone 2D4. Western Blot analysis of MTA1 expression in NIH/3T3.)

Western Blot (WB)

(MTA1 monoclonal antibody (M03), clone 2D4. Western Blot analysis of MTA1 expression in PC-12.)

Western Blot (WB)

(MTA1 monoclonal antibody (M03), clone 2D4. Western Blot analysis of MTA1 expression in A-431.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MTA1 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-MTA1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 115527080
• NCBI GeneID: 9112
• NCBI Accession #: NP_004680
• NCBI GenBank Nucleotide #: NP_004680.2
• UniProt Accession #: Q13330
• NCBI Official Full Name: metastasis-associated protein MTA1 isoform MTA1
• NCBI Official Synonym Full Names: metastasis associated 1
• NCBI Official Symbol: MTA1
• NCBI Protein Information: metastasis-associated protein MTA1
• UniProt Protein Name: Metastasis-associated protein MTA1
• Protein Family: Mating type protein
• UniProt Gene Name: MTA1
• UniProt Entry Name: MTA1_HUMAN

NCBI Description

This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

MTA1: metastasis-associated protein. A component of the NuRD ATP-dependent chromatin remodeling and histone deacetylase complex. Interacts with HDAC1. Expressed at high levels in metastatic cells. Two alternatively spliced isoforms have been described. The long isoform is a co-repressor of estrogen receptor (ER). The short isoform binds to ER and sequesters it in the cytoplasm and enhances non-genomic responses of ER.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 14q32.3

Cellular Component: nucleoplasm; microtubule; intracellular membrane-bound organelle; cytoplasm; nuclear envelope; NuRD complex; nucleus

Molecular Function: protein binding; zinc ion binding; transcription coactivator activity; chromatin binding; transcription factor activity; transcription corepressor activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; locomotor rhythm; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of transcription, DNA-dependent; double-strand break repair; regulation of inflammatory response; response to lipopolysaccharide; circadian regulation of gene expression; response to ionizing radiation; signal transduction; regulation of gene expression, epigenetic; entrainment of circadian clock by photoperiod