Mouse anti-Human MSRB1 Monoclonal Antibody | anti-MSRB1 antibody

MSRB1 (Methionine-R-sulfoxide Reductase B1, MsrB1, HSPC270, Selenoprotein X, SelX, SEPX1, SELR, SepR) (HRP)

Cat. Num. AAA6154890

• Gene Names: MSRB1; SELR; SELX; SepR; SEPX1; HSPC270
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MSRB1; Monoclonal Antibody; MSRB1 (Methionine-R-sulfoxide Reductase B1; MsrB1; HSPC270; Selenoprotein X; SelX; SEPX1; SELR; SepR) (HRP); EC=1.8.4.-; anti-MSRB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 8B2
• Specificity: Recognizes human SEPX1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MSRB1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-85 from human SEPX1 (NP_057416) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.35kD).)

Western Blot (WB)

(Western Blot analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody. Lane 1: SEPX1 transfected lysate (12.713kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SEPX1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-MSRB1 antibody

Antibodies; Selenoprotein

NCBI and Uniprot Product Information

• NCBI GI #: 7706511
• NCBI GeneID: 51734
• NCBI Accession #: NP_057416
• NCBI GenBank Nucleotide #: NM_016332
• UniProt Accession #: Q9NZV6; Q96RX6; Q9BTV2; Q9P0B1
• Molecular Weight: 14.8 kDa (136aa), confirmed by MALDI-TOF
• NCBI Official Full Name: methionine-R-sulfoxide reductase B1
• NCBI Official Synonym Full Names: methionine sulfoxide reductase B1
• NCBI Official Symbol: MSRB1
• NCBI Official Synonym Symbols: SELR; SELX; SepR; SEPX1; HSPC270
• NCBI Protein Information: methionine-R-sulfoxide reductase B1
• UniProt Protein Name: Methionine-R-sulfoxide reductase B1
• Protein Family: Methionine-R-sulfoxide reductase
• UniProt Gene Name: MSRB1
• UniProt Synonym Gene Names: SEPX1; MsrB1; SelX
• UniProt Entry Name: MSRB1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methionines. This protein is highly expressed in liver and kidney, and is localized to the nucleus and cytosol. It is the only member of the MsrB family that is a selenoprotein, containing a selenocysteine (Sec) residue at its active site. It also has the highest methionine-R-sulfoxide reductase activity compared to other members containing cysteine in place of Sec. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A pseudogene of this locus has been identified on chromosome 19. [provided by RefSeq, Aug 2017]

Uniprot Description

SEPX1: a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase (Msr) protein family which includes repair enzymes that reduce oxidized methionine residues in proteins. The protein encoded by this gene is expressed in a variety of adult and fetal tissues and localizes to the cell nucleus and cytosol. [provided by RefSeq, Mar 2012]

Protein type: Oxidoreductase; EC 1.8.4.-

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: cytoplasm; nucleus; actin cytoskeleton

Molecular Function: zinc ion binding; peptide-methionine (R)-S-oxide reductase activity; actin binding

Biological Process: protein repair; actin filament polymerization; innate immune response; response to oxidative stress