Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.35kD).)

Mouse anti-Human MSRB1 Monoclonal Antibody | anti-MSRB1 antibody

MSRB1 (Methionine-R-sulfoxide Reductase B1, MsrB1, HSPC270, Selenoprotein X, SelX, SEPX1, SELR, SepR) (AP)

Gene Names
MSRB1; SELR; SELX; SepR; SEPX1; HSPC270
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSRB1; Monoclonal Antibody; MSRB1 (Methionine-R-sulfoxide Reductase B1; MsrB1; HSPC270; Selenoprotein X; SelX; SEPX1; SELR; SepR) (AP); EC=1.8.4.-; anti-MSRB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8B2
Specificity
Recognizes human SEPX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MSRB1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-85 from human SEPX1 (NP_057416) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.35kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.35kD).)

Western Blot (WB)

(Western Blot analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody. Lane 1: SEPX1 transfected lysate (12.713kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody. Lane 1: SEPX1 transfected lysate (12.713kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SEPX1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SEPX1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-MSRB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.8 kDa (136aa), confirmed by MALDI-TOF
NCBI Official Full Name
methionine-R-sulfoxide reductase B1
NCBI Official Synonym Full Names
methionine sulfoxide reductase B1
NCBI Official Symbol
MSRB1
NCBI Official Synonym Symbols
SELR; SELX; SepR; SEPX1; HSPC270
NCBI Protein Information
methionine-R-sulfoxide reductase B1
UniProt Protein Name
Methionine-R-sulfoxide reductase B1
UniProt Gene Name
MSRB1
UniProt Synonym Gene Names
SEPX1; MsrB1; SelX
UniProt Entry Name
MSRB1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methionines. This protein is highly expressed in liver and kidney, and is localized to the nucleus and cytosol. It is the only member of the MsrB family that is a selenoprotein, containing a selenocysteine (Sec) residue at its active site. It also has the highest methionine-R-sulfoxide reductase activity compared to other members containing cysteine in place of Sec. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A pseudogene of this locus has been identified on chromosome 19. [provided by RefSeq, Aug 2017]

Uniprot Description

SEPX1: a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase (Msr) protein family which includes repair enzymes that reduce oxidized methionine residues in proteins. The protein encoded by this gene is expressed in a variety of adult and fetal tissues and localizes to the cell nucleus and cytosol. [provided by RefSeq, Mar 2012]

Protein type: Oxidoreductase; EC 1.8.4.-

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: cytoplasm; nucleus; actin cytoskeleton

Molecular Function: zinc ion binding; peptide-methionine (R)-S-oxide reductase activity; actin binding

Biological Process: protein repair; actin filament polymerization; innate immune response; response to oxidative stress

Research Articles on MSRB1

Similar Products

Product Notes

The MSRB1 msrb1 (Catalog #AAA6133678) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MSRB1 (Methionine-R-sulfoxide Reductase B1, MsrB1, HSPC270, Selenoprotein X, SelX, SEPX1, SELR, SepR) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSRB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSRB1 msrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSRB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.