Mouse anti-Human MS4A7 Monoclonal Antibody | anti-MS4A7 antibody

MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) APC

Cat. Num. AAA6137695

• Gene Names: MS4A7; CFFM4; MS4A8; 4SPAN2; CD20L4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MS4A7; Monoclonal Antibody; MS4A7 (4SPAN2; CD20L4; CFFM4; Membrane-spanning 4-domains Subfamily A Member 7; CD20 Antigen-like 4; CD20/FC-epsilon-RI-beta Family Member 4; Four-span Transmembrane Protein 2; MGC22368; MS4A8) APC; anti-MS4A7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2D3
• Specificity: Recognizes human MS4A7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-MS4A7 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-241 from human MS4A7 (AAH20673) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.51kD).)

Western Blot (WB)

(Western Blot analysis of MS4A7 expression in transfected 293T cell line by MS4A7 monoclonal antibody. Lane 1: MS4A7 transfected lysate (26.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MS4A7 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MS4A7 over-expressed 293 cell line, cotransfected with MS4A7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MS4A7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-MS4A7 antibody

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants.

Product Categories/Family for anti-MS4A7 antibody

Antibodies; Transmembrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18089081
• NCBI GeneID: 58475
• Molecular Weight: 21,404 Da
• NCBI Official Full Name: Homo sapiens membrane-spanning 4-domains, subfamily A, member 7, mRNA
• NCBI Official Synonym Full Names: membrane spanning 4-domains A7
• NCBI Official Symbol: MS4A7
• NCBI Official Synonym Symbols: CFFM4; MS4A8; 4SPAN2; CD20L4
• NCBI Protein Information: membrane-spanning 4-domains subfamily A member 7
• Protein Family: Membrane-spanning 4-domains subfamily

NCBI Description

This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq, Jul 2008]