Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (52.51kD).)

Mouse anti-Human MS4A7 Monoclonal Antibody | anti-MS4A7 antibody

MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MS4A7; Monoclonal Antibody; MS4A7 (4SPAN2; CD20L4; CFFM4; Membrane-spanning 4-domains Subfamily A Member 7; CD20 Antigen-like 4; CD20/FC-epsilon-RI-beta Family Member 4; Four-span Transmembrane Protein 2; MGC22368; MS4A8); Anti -MS4A7 (4SPAN2; anti-MS4A7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D3
Specificity
Recognizes human MS4A7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Applicable Applications for anti-MS4A7 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-241 from human MS4A7 (AAH20673) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.51kD).)

Western Blot (WB) (Western Blot detection against Immunogen (52.51kD).)

Western Blot (WB)

(Western Blot analysis of MS4A7 expression in transfected 293T cell line by MS4A7 monoclonal antibody. Lane 1: MS4A7 transfected lysate (26.1kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MS4A7 expression in transfected 293T cell line by MS4A7 monoclonal antibody. Lane 1: MS4A7 transfected lysate (26.1kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MS4A7 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MS4A7 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MS4A7 over-expressed 293 cell line, cotransfected with MS4A7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MS4A7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of MS4A7 over-expressed 293 cell line, cotransfected with MS4A7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MS4A7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-MS4A7 antibody
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants.
Product Categories/Family for anti-MS4A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
26,131 Da
NCBI Official Full Name
MS4A7
UniProt Protein Name
Membrane-spanning 4-domains subfamily A member 7
UniProt Gene Name
MS4A7
UniProt Synonym Gene Names
4SPAN2; CD20L4; CFFM4
UniProt Entry Name
MS4A7_HUMAN

Uniprot Description

MS4A7: May be involved in signal transduction as a component of a multimeric receptor complex. Belongs to the MS4A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12

Cellular Component: integral to membrane

Similar Products

Product Notes

The MS4A7 ms4a7 (Catalog #AAA641137) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MS4A7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the MS4A7 ms4a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLQSQTMGV SHSFTPKGIT IPQREKPGHM YQNEDYLQNG LPTETTVLGT VQILCCLLIS SLGAILVFAP YPSHFNPAIS TTLMSGYPFL GALCFGITGS LSIISGKQST KPFDLSSLTS NAVSSVTAGA GLFLLADSMV ALRTASQHCG SEMDYLSSLP YSEYYYPIYE IKDCLLTSVS LTGVLVVMLI FTVLELLLAA YSSVFWWKQL YSNNPGSSFS STQSQDHIQQ VKKSSSRSWI. It is sometimes possible for the material contained within the vial of "MS4A7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.