Mouse anti-Human MS4A6A Monoclonal Antibody | anti-MS4A6A antibody

MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090) (MaxLight 550)

Cat. Num. AAA6212604

• Gene Names: MS4A6A; CDA01; MS4A6; 4SPAN3; CD20L3; MST090; MSTP090; 4SPAN3.2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MS4A6A; Monoclonal Antibody; MS4A6A (4SPAN3; CD20L3; MS4A6; Membrane-spanning 4-domains Subfamily A Member 6A; CD20 Antigen-like 3; Four-span Transmembrane Protein 3; MGC131944; MGC22650; MST090) (MaxLight 550); anti-MS4A6A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D12
• Specificity: Recognizes human MS4A6A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-MS4A6A antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-248 from human MS4A6A with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (53.39kD) using 129912.)

Western Blot (WB)

(Western Blot analysis of MS4A6A expression in transfected 293T cell line using 129912. Lane 1: MS4A6A transfected lysate (26.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MS4A6A antibody

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants.

Product Categories/Family for anti-MS4A6A antibody

Antibodies; Transmembrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18605535
• NCBI GeneID: 64231
• Molecular Weight: 27,438 Da
• NCBI Official Full Name: Homo sapiens membrane-spanning 4-domains, subfamily A, member 6A, mRNA
• NCBI Official Synonym Full Names: membrane spanning 4-domains A6A
• NCBI Official Symbol: MS4A6A
• NCBI Official Synonym Symbols: CDA01; MS4A6; 4SPAN3; CD20L3; MST090; MSTP090; 4SPAN3.2
• NCBI Protein Information: membrane-spanning 4-domains subfamily A member 6A
• Protein Family: Membrane-spanning 4-domains subfamily

NCBI Description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants that encode different protein isoforms. [provided by RefSeq, Oct 2011]