Mouse anti-Human MRC1 Monoclonal Antibody | anti-MRC1 antibody

MRC1 (Macrophage Mannose Receptor 1, MMR, C-type Lectin Domain Family 13 Member D, C-type Lectin Domain Family 13 Member D-like, Macrophage Mannose Receptor 1-like Protein 1, CD206, CLEC13D, CLEC13DL, MRC1L1) (PE)

Cat. Num. AAA6158886

• Gene Names: MRC1; MMR; hMR; CD206; MRC1L1; CLEC13D; CLEC13DL; bA541I19.1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MRC1; Monoclonal Antibody; MRC1 (Macrophage Mannose Receptor 1; MMR; C-type Lectin Domain Family 13 Member D; C-type Lectin Domain Family 13 Member D-like; Macrophage Mannose Receptor 1-like Protein 1; CD206; CLEC13D; CLEC13DL; MRC1L1) (PE); anti-MRC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5C11
• Specificity: Recognizes human MRC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1456

• Applicable Applications for anti-MRC1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa22-130 from human MRC1 (NP_002429) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(MRC1 monoclonal antibody. Western Blot analysis of MRC1 expression in human pancreas.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MRC1 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-MRC1 antibody

Antibodies; Receptors

References

1. Xanthogranulomatous cholecystitis: A clinicopathological study of its association with gallbladder carcinoma. Zhuang PY, Zhu MJ, Wang JD, Zhou XP, Quan ZW, Shen J.J Dig Dis. 2012 Sep 21. doi: 10.1111/j.1751-2980.2012.00645.x. 2. Coronary Atherosclerosis Is Associated With Macrophage Polarization in Epicardial Adipose Tissue. Hirata Y, Tabata M, Kurobe H, Motoki T, Akaike M, Nishio C, Higashida M, Mikasa H, Nakaya Y, Takanashi S, Igarashi T, Kitagawa T, Sata M.J Am Coll Cardiol. 2011 Jul 12;58(3):248-55.

NCBI and Uniprot Product Information

• NCBI GI #: 4505245
• NCBI GeneID: 4360
• NCBI Accession #: NP_002429
• NCBI GenBank Nucleotide #: NM_002438
• UniProt Accession #: P22897
• NCBI Official Full Name: macrophage mannose receptor 1
• NCBI Official Synonym Full Names: mannose receptor C-type 1
• NCBI Official Symbol: MRC1
• NCBI Official Synonym Symbols: MMR; hMR; CD206; MRC1L1; CLEC13D; CLEC13DL; bA541I19.1
• NCBI Protein Information: macrophage mannose receptor 1
• UniProt Protein Name: Macrophage mannose receptor 1
• Protein Family: Macrophage mannose receptor
• UniProt Gene Name: MRC1
• UniProt Synonym Gene Names: CLEC13D; CLEC13DL; MRC1L1; MMR
• UniProt Entry Name: MRC1_HUMAN

NCBI Description

The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment.[provided by RefSeq, Sep 2015]

Uniprot Description

MRC1: Mediates the endocytosis of glycoproteins by macrophages. Binds both sulfated and non-sulfated polysaccharide chains. Acts as phagocytic receptor for bacteria, fungi and other pathogens. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p12.33

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; endosome membrane

Molecular Function: mannose binding; protein binding; transmembrane receptor activity; receptor activity

Biological Process: receptor-mediated endocytosis; signal transduction