Mouse anti-Human MOX1 Monoclonal Antibody | anti-MOX1 antibody

MOX1 (Homeobox Protein MOX-1, Mesenchyme Homeobox 1, MEOX1) (HRP)

Cat. Num. AAA6153570

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MOX1; Monoclonal Antibody; MOX1 (Homeobox Protein MOX-1; Mesenchyme Homeobox 1; MEOX1) (HRP); anti-MOX1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A10
• Specificity: Recognizes human MEOX1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 254

• Applicable Applications for anti-MOX1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa165-252 from human MEOX1 (NP_004518.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.42kD).)

Western Blot (WB)

(Western Blot analysis of MEOX1 expression in transfected 293T cell line by MEOX1 monoclonal antibody. Lane 1: MEOX1 transfected lysate (28kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MEOX1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-MOX1 antibody

Meox1 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. This protein may play a role in the molecular signaling network regulating somite development.

Product Categories/Family for anti-MOX1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4758710
• NCBI Accession #: NP_004518.1
• NCBI GenBank Nucleotide #: NM_004527
• UniProt Accession #: P50221
• NCBI Official Full Name: homeobox protein MOX-1 isoform 1
• UniProt Protein Name: Homeobox protein MOX-1
• UniProt Gene Name: MEOX1
• UniProt Synonym Gene Names: MOX1
• UniProt Entry Name: MEOX1_HUMAN

Uniprot Description

MEOX1: Role in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: somite specification; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter

Disease: Klippel-feil Syndrome 2, Autosomal Recessive