SDS-PAGE
C-X-C motif chemokine 14 Recombinant Protein | Cxcl14 recombinant protein
Recombinant Mouse C-X-C motif chemokine 14
Gene Names
Cxcl14; KS1; Kec; BMAC; BRAK; NJAC; MIP-2g; Scyb14; AI414372; bolekine; MIP2gamma; 1110031L23Rik; 1200006I23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C motif chemokine 14; Recombinant Mouse C-X-C motif chemokine 14; B-cell and monocyte-activating chemokine; Chemokine BRAK; Kidney-expressed chemokine CXCMIP-2G; Small-inducible cytokine B14; Cxcl14 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-99aa; Full Length
Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Sequence Length
99
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Cxcl14 recombinant protein
Chotactic for CESS B-cells and THP-1 monocytes, but not T-cells.
References
Cloning of BRAK, a novel divergent CXC chemokine preferentially expressed in normal versus malignant cells.Hromas R., Broxmeyer H.E., Kim C., Nakshatri H., Christopherson K. II, Azam M., Hou Y.-H.Biochem. Biophys. Res. Commun. 255:703-706(1999)
B cell- and monocyte-activating chemokine (BMAC)
, a novel non-ELR alpha-chemokine.Sleeman M.A., Fraser J.K., Murison J.G., Kelly S.L., Prestidge R.L., Palmer D.J., Watson J.D., Kumble K.D.Int. Immunol. 12:677-689(2000)
Molecular cloning and characterization of a novel CXC chemokine macrophage inflammatory protein-2 gamma chemoattractant for human neutrophils and dendritic cells.Cao X., Zhang W., Wan T., He L., Chen T., Yuan Z., Ma S., Yu Y., Chen G.J. Immunol. 165:2588-2595(2000)
Identification of a kidney-expressed chemokine (KEC)
, a member of the CXC family, that is selectively elevated in aprt knockout mice.Wang L., Deng L., Raikwar N., Sahota A., Tischfield J.A. Isolation of full-length cDNA clones from mouse brain cDNA library made by oligo-capping method.Osada N., Kusuda J., Tanuma R., Ito A., Hirata M., Sugano S., Hashimoto K.
Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Schilderink N., Geerts D.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13.4 kDa
NCBI Official Full Name
C-X-C motif chemokine 14
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 14
NCBI Official Symbol
Cxcl14
NCBI Official Synonym Symbols
KS1; Kec; BMAC; BRAK; NJAC; MIP-2g; Scyb14; AI414372; bolekine; MIP2gamma; 1110031L23Rik; 1200006I23Rik
NCBI Protein Information
C-X-C motif chemokine 14
UniProt Protein Name
C-X-C motif chemokine 14
Protein Family
UniProt Gene Name
Cxcl14
UniProt Synonym Gene Names
Bmac; Kec; Ks1; Mip2g; Scyb14
UniProt Entry Name
CXL14_MOUSE
Uniprot Description
CXCL14: Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays. Belongs to the intercrine alpha (chemokine CxC) family.
Protein type: Motility/polarity/chemotaxis; Chemokine; Secreted, signal peptide; Secreted
Cellular Component: extracellular region; extracellular space; Golgi apparatus
Molecular Function: chemokine activity; cytokine activity
Biological Process: immune response; inner ear development; negative regulation of myoblast differentiation
Research Articles on Cxcl14
Similar Products
Product Notes
The Cxcl14 cxcl14 (Catalog #AAA1265201) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-99aa; Full Length. The amino acid sequence is listed below: SKCKCSRKGP KIRYSDVKKL EMKPKYPHCE EKMVIVTTKS MSRYRGQEHC LHPKLQSTKR FIKWYNAWNE KRRVYEE. It is sometimes possible for the material contained within the vial of "C-X-C motif chemokine 14, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
