Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MEOX1 is approximately 1ng/ml as a capture antibody.)

Mouse MEOX1 Monoclonal Antibody | anti-MEOX1 antibody

MEOX1 (Mesenchyme Homeobox 1, MOX1) (AP)

Applications
ELISA
Purity
Purified
Synonyms
MEOX1; Monoclonal Antibody; MEOX1 (Mesenchyme Homeobox 1; MOX1) (AP); Mesenchyme Homeobox 1; MOX1; anti-MEOX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B11
Specificity
Recognizes MEOX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
254
Applicable Applications for anti-MEOX1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MEOX1 (NP_004518.1, 165aa-252aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MEOX1 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MEOX1 is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MEOX1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-MEOX1 antibody
This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-MEOX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
homeobox protein MOX-1 isoform 1
UniProt Protein Name
Homeobox protein MOX-1
Protein Family
UniProt Gene Name
MEOX1
UniProt Synonym Gene Names
MOX1
UniProt Entry Name
MEOX1_HUMAN

Uniprot Description

MEOX1: Role in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: somite specification; transcription, DNA-dependent; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter

Disease: Klippel-feil Syndrome 2, Autosomal Recessive

Similar Products

Product Notes

The MEOX1 meox1 (Catalog #AAA6163753) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MEOX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MEOX1 meox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MEOX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.