Mouse MORF4L1 Monoclonal Antibody | anti-MORF4L1 antibody

MORF4L1 (Mortality Factor 4 like 1, Eaf3, FWP006, HsT17725, MGC10631, MORFRG15, MRG15, S863-6) (AP)

Cat. Num. AAA6165783

• Gene Names: MORF4L1; Eaf3; MEAF3; MRG15; FWP006; S863-6; HsT17725; MORFRG15
• Applications: Western Blot
• Purity: Purified
• Synonyms: MORF4L1; Monoclonal Antibody; MORF4L1 (Mortality Factor 4 like 1; Eaf3; FWP006; HsT17725; MGC10631; MORFRG15; MRG15; S863-6) (AP); Mortality Factor 4 like 1; S863-6; anti-MORF4L1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6B6
• Specificity: Recognizes MORF4L1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-MORF4L1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MORF4L1 (NP_006782.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MORF4L1 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(MORF4L1 monoclonal antibody (M01), clone 6B6. Western Blot analysis of MORF4L1 expression in Jurkat.)

Related Product Information for anti-MORF4L1 antibody

Mouse monoclonal antibody raised against a partial recombinant MORF4L1.

Product Categories/Family for anti-MORF4L1 antibody

Antibodies; KIAA; orf

NCBI and Uniprot Product Information

• NCBI GI #: 5803102
• NCBI GeneID: 10933
• NCBI Accession #: NP_006782.1
• NCBI GenBank Nucleotide #: NM_006791.3
• UniProt Accession #: Q9UBU8; O95899; Q5QTS1; Q6NVX8; Q86YT7; Q9HBP6; Q9NSW5; B4DKN6; B7Z6R1; D3DW88
• Molecular Weight: 26,750 Da
• NCBI Official Full Name: mortality factor 4-like protein 1 isoform 1
• NCBI Official Synonym Full Names: mortality factor 4 like 1
• NCBI Official Symbol: MORF4L1
• NCBI Official Synonym Symbols: Eaf3; MEAF3; MRG15; FWP006; S863-6; HsT17725; MORFRG15
• NCBI Protein Information: mortality factor 4-like protein 1; protein MSL3-1; MORF-related gene 15 protein; Esa1p-associated factor 3 homolog; MORF-related gene on chromosome 15; transcription factor-like protein MRG15
• UniProt Protein Name: Mortality factor 4-like protein 1
• Protein Family: Mortality factor 4-like protein
• UniProt Gene Name: MORF4L1
• UniProt Synonym Gene Names: MRG15
• UniProt Entry Name: MO4L1_HUMAN

Uniprot Description

MORF4L1: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: nucleoplasm; NuA4 histone acetyltransferase complex; Sin3 complex

Molecular Function: protein binding; protein N-terminus binding; chromatin binding

Biological Process: cell proliferation; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of transcription, DNA-dependent; regulation of growth; histone deacetylation; double-strand break repair via homologous recombination