Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse MORF4L1 Monoclonal Antibody | anti-MORF4L1 antibody

MORF4L1 (Mortality Factor 4 like 1, Eaf3, FWP006, HsT17725, MGC10631, MORFRG15, MRG15, S863-6) (AP)

Gene Names
MORF4L1; Eaf3; MEAF3; MRG15; FWP006; S863-6; HsT17725; MORFRG15
Applications
Western Blot
Purity
Purified
Synonyms
MORF4L1; Monoclonal Antibody; MORF4L1 (Mortality Factor 4 like 1; Eaf3; FWP006; HsT17725; MGC10631; MORFRG15; MRG15; S863-6) (AP); Mortality Factor 4 like 1; S863-6; anti-MORF4L1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B6
Specificity
Recognizes MORF4L1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MORF4L1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MORF4L1 (NP_006782.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MORF4L1 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(MORF4L1 monoclonal antibody (M01), clone 6B6. Western Blot analysis of MORF4L1 expression in Jurkat.)

Related Product Information for anti-MORF4L1 antibody
Mouse monoclonal antibody raised against a partial recombinant MORF4L1.
Product Categories/Family for anti-MORF4L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,750 Da
NCBI Official Full Name
mortality factor 4-like protein 1 isoform 1
NCBI Official Synonym Full Names
mortality factor 4 like 1
NCBI Official Symbol
MORF4L1
NCBI Official Synonym Symbols
Eaf3; MEAF3; MRG15; FWP006; S863-6; HsT17725; MORFRG15
NCBI Protein Information
mortality factor 4-like protein 1; protein MSL3-1; MORF-related gene 15 protein; Esa1p-associated factor 3 homolog; MORF-related gene on chromosome 15; transcription factor-like protein MRG15
UniProt Protein Name
Mortality factor 4-like protein 1
UniProt Gene Name
MORF4L1
UniProt Synonym Gene Names
MRG15
UniProt Entry Name
MO4L1_HUMAN

Uniprot Description

MORF4L1: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: nucleoplasm; NuA4 histone acetyltransferase complex; Sin3 complex

Molecular Function: protein binding; protein N-terminus binding; chromatin binding

Biological Process: cell proliferation; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of transcription, DNA-dependent; regulation of growth; histone deacetylation; double-strand break repair via homologous recombination

Research Articles on MORF4L1

Similar Products

Product Notes

The MORF4L1 morf4l1 (Catalog #AAA6165783) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MORF4L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MORF4L1 morf4l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MORF4L1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual