Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-21R/Interleukin-21 Receptor Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)

IL-21R/Interleukin-21 Receptor Active Protein | IL-21R active protein

Recombinant Human IL-21R/Interleukin-21 Receptor Protein

Gene Names
IL21R; NILR; CD360; IMD56
Purity
>90% by SDS-PAGE.
Synonyms
IL-21R/Interleukin-21 Receptor; Recombinant Human IL-21R/Interleukin-21 Receptor Protein; CD360; NILR; IL-21R active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNP
Sequence Length
538
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to inhibit IL-21-dependent proliferation of N1186 human T cells Parrish-Novak, J. et al. (2000) Nature 408:57. The ED50 for this effect is 0.6-3.6 ug/mL in the presence of 100 ng/mL of recombinant human IL-21.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-21R/Interleukin-21 Receptor Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)

SDS-Page (Recombinant Human IL-21R/Interleukin-21 Receptor Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)
Related Product Information for IL-21R active protein
Description: Recombinant Human IL-21R/Interleukin-21 Receptor Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Cys20-Pro236) of human IL-21R/Interleukin-21 Receptor (Accession #NP_068570.1) fused with a 6xHis tag at the C-terminus.

Background: Interleukin-21 receptor, also known as IL-21 receptor, IL-21R, Novel interleukin receptor, IL21R and NILR, is a single-pass type I membrane protein which belongs to the type I cytokine receptor family and Type 4 subfamily. Interleukin-21 (IL-21) belongs to a family of cytokines,and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3.
Product Categories/Family for IL-21R active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-21 receptor isoform 1
NCBI Official Synonym Full Names
interleukin 21 receptor
NCBI Official Symbol
IL21R
NCBI Official Synonym Symbols
NILR; CD360; IMD56
NCBI Protein Information
interleukin-21 receptor
UniProt Protein Name
Interleukin-21 receptor
UniProt Gene Name
IL21R
UniProt Synonym Gene Names
NILR; IL-21 receptor; IL-21R
UniProt Entry Name
IL21R_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010]

Uniprot Description

IL21R: This is a receptor for interleukin-21

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 16p11

Disease: Ige Responsiveness, Atopic; Il21r Immunodeficiency

Research Articles on IL-21R

Similar Products

Product Notes

The IL-21R il21r (Catalog #AAA9141698) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CPDLVCYTDY LQTVICILEM WNLHPSTLTL TWQDQYEELK DEATSCSLHR SAHNATHATY TCHMDVFHFM ADDIFSVNIT DQSGNYSQEC GSFLLAESIK PAPPFNVTVT FSGQYNISWR SDYEDPAFYM LKGKLQYELQ YRNRGDPWAV SPRRKLISVD SRSVSLLPLE FRKDSSYELQ VRAGPMPGSS YQGTWSEWSD PVIFQTQSEE LKEGWNP. It is sometimes possible for the material contained within the vial of "IL-21R/Interleukin-21 Receptor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.