Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MOGAT3 Monoclonal Antibody | anti-MOGAT3 antibody

MOGAT3 (2-acylglycerol O-acyltransferase 3, Acyl-CoA:monoacylglycerol Acyltransferase 3, MGAT3, Diacylglycerol O-acyltransferase Candidate 7, hDC7, Diacylglycerol Acyltransferase 2-like Protein 7, Monoacylglycerol O-acyltransferase 3, DC7, DGAT2L7, UNQ938

Gene Names
MOGAT3; DC7; MGAT3; DGAT2L2
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MOGAT3; Monoclonal Antibody; MOGAT3 (2-acylglycerol O-acyltransferase 3; Acyl-CoA:monoacylglycerol Acyltransferase 3; MGAT3; Diacylglycerol O-acyltransferase Candidate 7; hDC7; Diacylglycerol Acyltransferase 2-like Protein 7; Monoacylglycerol O-acyltransferase 3; DC7; DGAT2L7; UNQ938; anti-MOGAT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F7
Specificity
Recognizes human MOGAT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
341
Applicable Applications for anti-MOGAT3 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa59-108 from human MOGAT3 (NP_835470) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-MOGAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
2-acylglycerol O-acyltransferase 3 isoform a
NCBI Official Synonym Full Names
monoacylglycerol O-acyltransferase 3
NCBI Official Symbol
MOGAT3
NCBI Official Synonym Symbols
DC7; MGAT3; DGAT2L2
NCBI Protein Information
2-acylglycerol O-acyltransferase 3
UniProt Protein Name
2-acylglycerol O-acyltransferase 3
UniProt Gene Name
MOGAT3
UniProt Synonym Gene Names
DC7; DGAT2L7; MGAT3; hDC7

NCBI Description

Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM, Mar 2008]

Uniprot Description

Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes.

Research Articles on MOGAT3

Similar Products

Product Notes

The MOGAT3 mogat3 (Catalog #AAA6212567) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MOGAT3 (2-acylglycerol O-acyltransferase 3, Acyl-CoA:monoacylglycerol Acyltransferase 3, MGAT3, Diacylglycerol O-acyltransferase Candidate 7, hDC7, Diacylglycerol Acyltransferase 2-like Protein 7, Monoacylglycerol O-acyltransferase 3, DC7, DGAT2L7, UNQ938 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOGAT3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MOGAT3 mogat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MOGAT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.